Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   IDS/Iduronate 2 Sulfatase PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 156pg/ml, For Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-548
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Hamartin antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hamartin, Application: IHC-P, WB.
Catalog Number: 10209-940
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Osteoactivin/GPNMB, Immunogen: NSO, K23-N502, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-204
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich Picokine* ELISA kit of quantitative detection for human CD105 Immunogen: CHO, E26-G586 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 15 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-814
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FMRP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM, Synonyms: fragile X mental retardation protein 1, FMRP, Protein FMR-1, Application: WB, Size: 100ug/vial
Catalog Number: 76174-222
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Carbonic Anhydrase III antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Carbonic Anhydrase III(2-20aa AKEWGYASHNGPDHWHELF).
Catalog Number: 10206-008
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MPS1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human MPS1 recombinant protein (P2-H84), Synonyms: 40S ribosomal protein S27, Application: IHC-P, Western blot, size: 100ug/vial
Catalog Number: 76173-100
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   VNN1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human VNN1 recombinant protein (Q22-K192), Synonym: Pantetheinase; 3.5.1.92, Pantetheine hydrolase, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-126
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   DTK/TYRO3 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 125pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-598
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat VEGF, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 1 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), 96-well plate precoated
Catalog Number: 10205-866
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Alpha-Adaptin Antibody monoclonal, Host: Mouse, Species Reactivity: Human, rat, Isotype:IgG, Clone number Ada-1, Immunogen: AP-2 adaptor polypeptides from bovine brain, for alpha-Adaptin, adaptor-related protein complex 2, alpha 1 subunit (AP2A1 ) detection.
Catalog Number: 10205-930
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Tyrosine Hydroxylase Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence in middle region (193-222aa), Synonyms: TYH, Application: WB, size: 100ug/vial
Catalog Number: 76173-728
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   EGFR PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species reactivity: Mouse, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-336
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FITC conjugated rabbit rat IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.5mg
Catalog Number: 10208-948
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MIP-2, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived rat CXCL2 recombinant protein, Synonyms: C-X-C motif chemokine 2, Cytokine-induced neutrophil chemoattractant 3, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76174-572
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   KCNH1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA), Synonym: Ether-a-go-go potassium channel 1, Application: WB, Size:100ug
Catalog Number: 76171-272
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
145 - 160  of 6,137
Prev   10  11  12  13  14  15  16  17  18  19  20  21  22  23  24  25  Next