Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   CXCL5/ENA-78, Polyclonal Antibody, Host: Rabbit, Species: Rat, Isotype: IgG, Immunogen: E. Coli-derived rat CXCL5 recombinant protein, Synonyms: C-X-C motif chemokine 5, Cytokine LIX, Small-inducible cytokine B5, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76174-574
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Myosin Phosphatase antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Myosin Phosphatase(1-17aa MKMADAKQKRNEQLKRW).
Catalog Number: 10206-140
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   YAP1/Yap Picoband* Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa), Synonym: YAP1, YAP65, Application: WB, Size: 100ug/vial
Catalog Number: 76174-772
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human P53, Immunogen: NSO, M1-D393, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell lysates, 96-well plate precoated
Catalog Number: 10205-854
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Cyclin A1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human Cyclin A1 recombinant protein, Synonyms: Cyclin-A1, CCNA1, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76173-838
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MMP-13 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: corresponding to a sequence at the N-terminus of human MMP13 (109-154aa), Synonym: Collagenase 3, 3.4.24.-, Matrix metalloproteinase-13, MMP-13, MMP13, Application: WB, Size:100ug
Catalog Number: 76171-020
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Profilin 2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Profilin 2(125-140aa NKKAYSMAKYLRDSGF), identical to the related mouse and rat sequences.
Catalog Number: 10206-434
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FH/Fumarase Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human FH (YDKaa), Synonym: Fumarate hydratase, mitochondrial, Fumarase, 4.2.1.2, FH, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-562
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   UBA1/Ube1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN, Synonyms: Ubiquitin-like modifier-activating enzyme 1, 6.2.1.45, Size: 100ug/vial
Catalog Number: 76174-648
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Oct-1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Oct-1 recombinant protein (S11-Q240), Synonyms: POU domain, class 2, transcription factor 1, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-468
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PMP70 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PMP70(646-659aa EFKQITEDTVEFGS), different from the related mouse and rat sequences by one amino acid
Catalog Number: 10207-004
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Hsp70 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70, Application: IHC-P, IHC-F, ICC, WB.
Catalog Number: 10209-976
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD146 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: E.coli-derived human CD146 recombinant protein, Synonym: Cell surface glycoprotein MUC18, CD146, MCAM, MUC18, Application: Western blot, IHC-P, Size: 100ug/vial
Catalog Number: 76174-900
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   GIP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse GIP recombinant protein, Synonyms: GIP, Glucose-dependent insulinotropic polypeptide, Gip, Application: WB, Size: 100ug/vial
Catalog Number: 76174-732
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   RNH1/Ribonuclease Inhibitor Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 2-37aa SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDD, Synonyms: Placental ribonuclease inhibitor, Size: 100ug/vial
Catalog Number: 76174-610
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-376
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
177 - 192  of 6,137
Prev   12  13  14  15  16  17  18  19  20  21  22  23  24  25  26  27  Next