Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76464-392
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   AMHR2/Mis Rii Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus, Synonym: MISRII, MRII, AMHR2, AMHR, Application: WB, Size: 100ug/vial
Catalog Number: 76174-782
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PI 3 Kinase p85 beta antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, A synthetic peptide corresponding to a sequence in the middle region of human PI 3 Kinase p85 beta(447-461aa KVYHQQYQDKSREYD).
Catalog Number: 10206-100
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ACVR2A/Actr Ii Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human ACVR2A recombinant protein (Q421-L513), Synonyms: Activin receptor type-2A; 2.7.11.30, Application: WB, size: 100ug/vial
Catalog Number: 76172-368
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FGF19 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human FGF19 recombinant protein (L25-K216), Synonyms: Fibroblast growth factor 19; FGF-19, Application: ELISA, Western blot, size: 100ug/vial
Catalog Number: 76173-036
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL12B/Il 12 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Immunogen: E. Coli-derived human IL12B recombinant protein (Position: I23-E253), Synonym: NKSF2, IL12B, NKSF2, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-342
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   GCN2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse GCN2(868-886aa ATDHLAFTAEGKQDDQAGD), different from the related rat sequence by one amino acid
Catalog Number: 10207-348
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CD68 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CD68(312-326aa AFCITRRRQSTYQPL), different from the related rat sequence by one amino acid, Application: Western Blot
Catalog Number: 10207-174
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-592
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Myoglobin antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Myoglobin(138-154aa LFRNDIAAKYKELGFQG), identical to the related rat sequence.
Catalog Number: 10206-504
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SECTM1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: 118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK, Synonyms: Secreted and transmembrane protein 1b, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76174-174
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CCR5 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCR5(19-34aa PCQKINVKQIAARLLP), different from the related rat sequence by two amino acids.
Catalog Number: 10208-144
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   P73 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human p73 recombinant protein (M1-E198), Synonyms: Tumor protein p73, Form: Lyophilised, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-336
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-276
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Bax Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa), Synonym: BAX, BCL2L4, Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76170-724
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SCF antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Immunogen: E. coli-derived human SCF recombinant protein(Position: E26-A190), for Kit ligand/Mast cell growth factor(KITLG) detection
Catalog Number: 10209-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
289 - 304  of 6,135
Prev   19  20  21  22  23  24  25  26  27  28  29  30  31  32  33  34  Next