Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Kallikrein 10 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Kallikrein 10(252-265aa SAQHPAVYTQICKY)
Catalog Number: 10209-210
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   5HT2A Receptor Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: serotonin, Synonyms: 5-hydroxytryptamine receptor 2A, 5-HT-2, 5-HT-2A, Application: Western blot, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-054
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-130
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CTCF Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human CTCF recombinant protein, Synonyms: Transcriptional repressor CTCF, 11-zinc finger protein, CCCTC-binding facto, Size: 100ug/vial
Catalog Number: 76173-854
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   RPA70 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR, Synonyms: Replication protein A 70 kDa DNA-binding subunit, RP-A p70, Application: WB, Size: 100ug/vial
Catalog Number: 76174-612
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-162
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD1D Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD1d(76-92aa FSDQQWETLQHIFRVYR), Application: Western Blot
Catalog Number: 10207-308
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TRAF2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TRAF2(305-325aa RQHRLDQDKIEALSSKVQQLE), different from the related rat and mouse sequences by one amino acid
Catalog Number: 10206-962
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Prion protein PrP polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Prion protein PrP(143-159aa DWEDRYYRENMYRYPNQ)
Catalog Number: 10209-150
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   RFC1 Polyclonal Antibody, Host: Rabbit, Species: Human Rat Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RFC1(46-64aa NSSRKEDDFKQKQPSKKKR), Application: Western Blot, IHC-P
Catalog Number: 10207-240
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SFRP2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human SFRP2 recombinant protein (L104-C295), Synonyms: Secreted frizzled-related protein 2; FRP-2;, Application: ELISA, WB, size: 100ug/vial
Catalog Number: 76173-558
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   RUNX3/Cbfa3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human RUNX3 recombinant protein (M128-Y270), Synonyms: Runt-related transcription factor 3, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-696
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*IL36 Alpha Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human IL36 alpha recombinant protein (Position: K6-F158), Synonyms: Interleukin-36 alpha, FIL1 epsilon, Uses: ELISA, WB, Size: 100ug/vial
Catalog Number: 76172-038
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TJP2 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse TJP2(1149-1167aa AHSKRGYYSQPSRYRDTEL), identical to the related rat sequence.
Catalog Number: 10209-802
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CRM1 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human CRM1 recombinant protein, Synonym: Exportin-1, Exp1, Application: Western blot, IHC-P, IHC-F, Size: 100 ug/vial
Catalog Number: 76174-770
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL1 beta Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE), Synonym: Interleukin-1 beta, IL-1 beta, Il1b, Application: WB, Size:100ug
Catalog Number: 76170-792
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
305 - 320  of 6,135
Prev   20  21  22  23  24  25  26  27  28  29  30  31  32  33  34  35  Next