Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   Cathepsin K Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human Cathepsin K recombinant protein, Synonyms: Cathepsin K, 3.4.22.38, Cathepsin O, Cathepsin O2, CTSO2, Size: 100ug/vial
Catalog Number: 76174-568
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Cytochrome C polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome C(91-105 aa ERADLIAYLKKATNE)
Catalog Number: 10209-230
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MPS1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human MPS1 recombinant protein (P2-H84), Synonyms: 40S ribosomal protein S27, Application: IHC-P, Western blot, size: 100ug/vial
Catalog Number: 76173-100
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*AFF4 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4, Synonyms: AF4/FMR2 family member 4, Application: Western blot, Size: 100ug/vial
Catalog Number: 76171-788
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-256
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Bcl-X Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF, Synonyms: Bcl-2-like protein 1, Bcl2-L-1, Apoptosis regulator Bcl-X, BCL2L1, BCL2L, BCLX, Size: 100ug/vial
Catalog Number: 76174-672
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-946
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Beta-TublinAntibody monoclonal, Host: Mouse, Species Reactivity: Human, rat, Isotype:IgG, Clone number TUB-2, Immunogen: Tubulin from rat brain, for beta-Tubulin detection, Tested with WB, IHC-P.
Catalog Number: 10205-942
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IRS1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human IRS1 recombinant protein(S1041-Q1242), Synonym: Insulin receptor substrate 1; IRS-1, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-312
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TSLP Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Immunogen: A synthetic peptide corresponding to a sequence of human TSLP (KVTTNKCLEQVSQLQGLWRRFNRPLLKQQ), Synonym: Thymic stromal lymphopoietin, TSLP, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-310
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*BRMS1 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human BRMS1, Synonyms: Breast cancer metastasis-suppressor 1, BRMS1, Application: WB, Size: 100ug/vial
Catalog Number: 76171-774
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Ceruloplasmin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived mouse Ceruloplasmin recombinant protein, Synonyms: Ceruloplasmin, 1.16.3.1, Ferroxidase, Cp, Size: 100ug/vial
Catalog Number: 76174-562
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PON1 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, Rat, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PON1, Application: WB.
Catalog Number: 10210-004
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   HNF1 beta antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta(494-509aa HMAQQPFMAAVTQLQN), identical to the related mouse and rat sequences.
Catalog Number: 10206-520
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Vitamin D Receptor antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Vitamin D Receptor(389-404aa DLRSLNEEHSKQYRCL).
Catalog Number: 10206-144
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ZP2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD, Synonyms: Zona pellucida sperm-binding protein 2, Zona pellucida glycoprotein 2, Size: 100ug/vial
Catalog Number: 76174-662
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
401 - 416  of 6,135
Prev   26  27  28  29  30  31  32  33  34  35  36  37  38  39  40  41  Next