Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   LAMC2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LAMC2(1160-1180aa ETSIDGILADVKNLENIRDNL), identical to the related rat and mouse sequences, Application:, IHC-P
Catalog Number: 10206-862
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-018
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-224
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ROC1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH, Synonyms: E3 ubiquitin-protein ligase RBX1, 6.3.2.-, Protein ZYP, Application: WB, Size: 100ug/vial
Catalog Number: 76174-452
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IRF5 Polyclonal Antibody, Host: Rabbit, Species: Human Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5, identical to the related rat sequence, and different from the related mouse sequence by two amino acids
Catalog Number: 10207-414
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-982
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   KU70 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Ku70(530-545aa YPPDYNPEGKVTKRKH), Application: Western Blot
Catalog Number: 10207-214
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PROM1/Cd133 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PROM1 (808-841aa), Synonym: PROML1, MSTP061, Application: WB, Size:100ug
Catalog Number: 76171-500
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   COL18A1/Endostatin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human COL18A1 recombinant protein, Synonym: Collagen alpha-1(XVIII) chain, Endostatin, COL18A1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-400
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CCR4 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CCR4(346-360aa, SYTQSTVDHDFRDAL), identical to the related rat sequence, Application: Western Blot, IHC-P
Catalog Number: 10207-172
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PIK3R2/Pi 3 Kinase P85 Beta Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: KYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQL, Synonyms: Phosphatidylinositol 3-kinase regulatory subunit beta, Size: 100ug/vial
Catalog Number: 76174-370
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   RPSA Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human RPSA recombinant protein (S2-S138), Synonyms: 40S ribosomal protein SA; RPSA ; LAMBR, LAMR1, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-102
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Osteocalcin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse Osteocalcin recombinant protein, Synonyms: Gamma-carboxyglutamic acid-containing protein, Bglap, Size: 100ug/vial
Catalog Number: 76174-676
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   GCLC polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GCLC(7-24aa GSPLSWEETKRHADHVRR), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10209-754
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ABCB11/Bsep Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (1175-1199aa), Synonyms: Bile salt export pump, Application: WB, size: 100ug/vial
Catalog Number: 76173-660
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   POR/Cytochrome P450 Reductase Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK, Synonyms: NADPH--cytochrome P450 reductase, Size: 100ug/vial
Catalog Number: 76174-288
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
465 - 480  of 6,135
Prev   30  31  32  33  34  35  36  37  38  39  40  41  42  43  44  45  Next