Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Peroxiredoxin 2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 2(181-198aa DTIKPNVDDSKEYFSKHN).
Catalog Number: 10206-276
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Aquaporin 4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 4(258-274aa FKRRFKEAFSKAAQQTK).
Catalog Number: 10206-372
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-910
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PTEN Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human PTEN recombinant protein (E91-V403), Synonyms: Phosphatase and tensin homolog; PTEN; MMAC1, TEP1, Application: WB, size: 100ug/vial
Catalog Number: 76173-604
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   FITC conjugated goat mouse IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC, Pack Size: 0.5mg
Catalog Number: 10208-944
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL33 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human IL33 recombinant protein (Position: A95-T270), Synonym: Interleukin-33, IL-33, Interleukin-1 family member 11, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76170-800
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FUT1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL, Synonyms: Blood group H alpha 2-fucosyltransferase, Fucosyltransferase 1, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-042
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Intestinal FABP antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human intestinal FABP(15-37aa YDKFMEKMGVNIVKRKLAAHDNL).
Catalog Number: 10206-248
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   KIAA0652 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ, Synonyms: Autophagy-related protein 13, ATG13, KIAA0652, Application: WB, Size: 100ug/vial
Catalog Number: 76173-828
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   EWSR1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH, Synonyms: RNA-binding protein EWS, EWS oncogene, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-026
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL22 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse IL22 recombinant protein (Position: L34-V179), Synonym: IL-22a, Il22, Il22a, Iltif, Iltifa, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-248
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-450
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MTCO1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MTCO1(2-14aa FADRWLFSTNHKD).
Catalog Number: 10209-544
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Cdk4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Cdk4(283-303aa RISAFRALQHSYLHKEESDAE)
Catalog Number: 10209-742
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FGF8 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human FGF8 recombinant protein (Position: Q23-R233), Synonym: HBGF-8, FGF8, AIGF, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-188
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Semaphorin 3A Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Semaphorin 3A recombinant protein, Synonym: Semaphorin-3A, Semaphorin III, Sema III, SEMA3A, SEMAD, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-498
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
593 - 608  of 6,135
Prev   38  39  40  41  42  43  44  45  46  47  48  49  50  51  52  53  Next