Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
So much has changed during this unprecedented time, except your ability to count on Avantor. We continue to set science in motion to create a better world by providing you with the right solutions to keep moving forward.
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
Avantor supports end-to-end fluid management solutions – including peristaltic pumps and aseptic fluid transfer solutions – that are reliable and customer-centric, helping bioprocessing manufacturers meet their research and production goals.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
New Avantor® J.T.Baker® premium conductive and non-conductive robotic tips deliver superior quality and reliable performance for results you can trust.
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
The Equipment & Instrument Service Team’s focus is to provide comprehensive service solutions for our customers. We provide validation, calibration, preventative maintenance, and extended warranties on all equipment & instruments in and around the laboratory.
Description:
CD18 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids
Description:
Picoband*CP110 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human CP110 recombinant protein (Position: E51-H284), Synonyms: Centriolar coiled-coil protein of 110 kDa, Uses: ELISA, IHC-P, WB, Size: 100ug/vial
Description:
Egr1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Egr1(23-43aa FPHSPTMDNYPKLEEMMLLSN), identical to the related rat and mouse sequences.
Description:
HSP60 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat HSP60(503-516aa YDAMLGDFVNMVEK), different from the related human sequence by one amino acid
Description:
Integrin alpha 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Integrin alpha 1(1121-1134aa SNQKRELAIQISKD).
Description:
CD168 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD168(706-724aa KEGNTNCYRAPMECQESWK).
Print…
List View
Easy View
