Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   VDR/Nr1I1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 377-402aa HLLYAKMIQKLADLRSLNEEHSKQYR, Synonyms: 1,25-dihydroxyvitamin D3 receptor, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-742
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TdT Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human TdT recombinant protein (K316-A509), Synonyms: DNA nucleotidylexotransferase; 2.7.7.31, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-202
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MMP9 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, A synthetic peptide corresponding to a sequence at the C-terminus of human MMP9, different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids
Catalog Number: 10207-146
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*MED8 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human MED8 recombinant protein, Synonyms: Mediator of RNA polymerase II transcription subunit 8, Application: ELISA, IHC-P, WB, Size: 100ug/vial
Catalog Number: 76172-006
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   NDRG2 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2(212-230aa ELIQKYRNIITHAPNLDNI).Application: WB
Catalog Number: 10208-126
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Biotin conjugated goat mouse IgG secondary antibody. Application: ELISA, IHC-P, IHC-F, ICC, WB. Pack Size: 1mg
Catalog Number: 10208-884
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Pea3 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD, Synonyms: Polyomavirus enhancer activator 3 homolog, Protein PEA3, Application: WB, Size: 100ug/vial
Catalog Number: 76174-214
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IKB Alpha Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human IKB alpha recombinant protein (Q3-Q112), Synonyms: NF-kappa-B inhibitor alpha, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-416
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SOD2/Mnsod Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (192-222aa), Synonyms: Superoxide dismutase [Mn], Application: WB, size: 100ug/vial
Catalog Number: 76173-716
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   NOX2/gp91phox, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human NOX2/gp91phox recombinant protein (Position: F416-D500), Synonym: Cytochrome b-245 heavy chain, CGD91-phox, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-964
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-266
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD40 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD40(20-37aa, PEPPTACREKQYLINSQC).
Catalog Number: 10209-724
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IL-18 Polyclonal Antibody, Host: Rabbit, Species reactivity: Rat, Immunogen: E.coli-derived rat IL-18 recombinant protein (H37-S194), Synonyms: Interleukin-18; IL-18, Interferon gamma-inducing factor, Il18; Igif, Application: Western Blot, size: 100ug/vial
Catalog Number: 76172-938
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD3 epsilon Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human CD3 epsilon recombinant protein (Position: D23-I207), Human CD3 epsilon shares 65% amino acid
Catalog Number: 10209-316
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-918
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   STAT3 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human STAT3 recombinant protein Position: A2-R215, Synonym: Acute-phase response factor, STAT3, APRF, Application: WB, Size:100ug
Catalog Number: 76170-742
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
865 - 880  of 6,135
Prev   55  56  57  58  59  60  61  62  63  64  65  66  67  68  69  70  Next