Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   Synaptotagmin 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human Synaptotagmin 1 (RRPIAQWHTLQVEEEVDAMLAVKK), Synonym: SYT, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-604
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MDMX Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH, Synonyms: Protein Mdm4, Double minute 4 protein, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-584
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-876
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-326
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Annexin A2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin A2(121-141aa RAEDGSVIDYELIDQDARDLY)
Catalog Number: 10209-352
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MEK2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEK2(2-20aa LARRKPVLPALTINPTIAE), identical to the related mouse and rat sequences, Application: Western Blot, IHC-P
Catalog Number: 10207-432
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76468-084
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Synaptophysin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence at N-terminus (1-26aa), Synonyms: Synaptophysin; SYP, Application: WB, size: 100ug/vial
Catalog Number: 76173-652
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76468-016
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich Picokine* ELISA kit of quantitative detection for mouse MMP-12 Immunogen: NSO, A18-C462 Assay range: 62.5pg/ml-4000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin).
Catalog Number: 10207-716
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Notch1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Notch1 (1797-1827aa), Synonym: NICD, NOTCH1, TAN1, Application: WB, Size:100ug
Catalog Number: 76170-758
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   FSTL3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FSTL3(145-159aa ECELRAARCRGHPDL), different from the related rat and mouse sequences by one amino acid
Catalog Number: 10206-940
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse EGF, Immunogen: E.coli, N977-R1029, Range: 15.6pg/ml -1000pg/ml, Sensitivity: > 1pg/ml, Sample: cell culture supernates, serum, plasma(heparin, EDTA), tissue homogenates and urine, 96-well plate precoated
Catalog Number: 10205-816
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   12 Lipoxygenase Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus of human ALOX12(609-628aa), Synonyms: Polyubiquitin-B; Ubiquitin; UBB, Application: WB, size: 100ug/vial
Catalog Number: 76172-880
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76468-128
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*Aquaporin 9 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: Synthetic peptide corresponding to a sequence of human Aquaporin 9, Synonym: Aquaporin-9, AQP-9, Aquaglyceroporin-9, Small solute channel 1, Uses: WB, Size: 100ug/vial
Catalog Number: 76171-776
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
113 - 128  of 6,137
Prev   8  9  10  11  12  13  14  15  16  17  18  19  20  21  22  23  Next