Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   TFF1/Ps2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human TFF1 recombinant protein, Synonyms: Trefoil factor 1, Breast cancer estrogen-inducible protein, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76173-910
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PD-L1/B7-H1 PicoKine* ELISA Kit, Sensitivity: <12pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 62.5pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-544
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   KChIP2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR, Synonyms: Kv channel-interacting protein 2, KChIP2, KCNIP2, KCHIP2, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-160
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   AKT2 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, A synthetic peptide corresponding to a sequence at the C-terminus of human AKT2(454-481aa DRYDSLGLLELDQRTHFPQFSYSASIRE)
Catalog Number: 10209-862
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Aquaporin 3 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 3(278-292aa EENVKLAHVKHKEQI), different from the related rat and mouse.
Catalog Number: 10208-018
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-650
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-360
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CDK5 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cdk5(273-292aa QRISAEEALQHPYFSDFCPP), identical to the related rat and mouse sequence
Catalog Number: 10207-186
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat FGF1, Immunogen: E.coli, F16-D155, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-872
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Glutamate receptor 3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Glutamate receptor 3(394-412aa RKAGYWNEYERFVPFSDQQ)
Catalog Number: 10209-134
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MCM7 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human MCM7 recombinant protein (D526-V719), Synonyms: DNA replication licensing factor MCM7; 3.6.4.12, Application: WB, size: 100ug/vial
Catalog Number: 76173-356
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   EAAT3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human EAAT3(10-27aa EWKRFLKNNWVLLSTVAA).
Catalog Number: 10209-664
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Galectin-3BP PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin), Species reactivity: Human, Assay Range: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-408
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Chemerin/RARRES2, Immunogen: E.coli, V17-S163, Assay range: 0.78ng/ml-50ng/ml, Sensitivity: < 20 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-520
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Angiotensin Converting Enzyme 1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Angiotensin Converting Enzyme 1
Catalog Number: 10209-082
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TIMP2 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIMP2(205-220aa RGAAPPKQEFLDIEDP), identical to the related mouse and rat sequences.
Catalog Number: 10206-774
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
129 - 144  of 6,137
Prev   9  10  11  12  13  14  15  16  17  18  19  20  21  22  23  24  Next