Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
So much has changed during this unprecedented time, except your ability to count on Avantor. We continue to set science in motion to create a better world by providing you with the right solutions to keep moving forward.
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
Avantor supports end-to-end fluid management solutions – including peristaltic pumps and aseptic fluid transfer solutions – that are reliable and customer-centric, helping bioprocessing manufacturers meet their research and production goals.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
New Avantor® J.T.Baker® premium conductive and non-conductive robotic tips deliver superior quality and reliable performance for results you can trust.
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
Description:
Alkaline Phosphatase antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat Alkaline Phosphatase(18-32aa, FVPEKEKDPSYWRQQ).
Description:
VEGF Receptor 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human VEGF Receptor 1(1299-1317aa HVSEGKRRFTYDHAELERK). Application: WB
Description:
Calpastatin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa), Synonym: CAST, Application: IHC-P, WB, Size:100ug
Description:
IL4 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human IL4(72-88aa, AATVLRQFYSHHEKDTR), Application: Western Blot, IHC-P
Description:
SKP2 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human SKP2 (ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL), Synonym: FBXL1, Application: WB, Size:100ug
Description:
Iba1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa), Synonym: G1, AIF1, G1, IBA1, Application: IHC-P, WB, Size:100ug
Description:
Beta III Tubulin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa), Synonym: TUBB4, Application: IHC-P, WB, Size:100ug
Description:
CDK7 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cdk7(329-346aa RKRTEALEQGGLPKKLIF), different from the related rat and mouse sequences by two amino acids
Description:
NMDAR1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFaa), Synonym: NMD-R1, GRIN1, NMDAR1, Application: WB, Size:100ug
Description:
Cytokeratin Peptide 18 monoclonal antibody, Host: Mouse, Species Reactivity: Human, Rat, CK-18, isotype: IgG1, The human epidermal carcinoma A-431 and MCF-7 human breast cancer cell lines
Description:
IL12 p40 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IL12 p40(23-40aa IWELKKDVYVVELDWYPD).
Description:
OPCML Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human OPCML(294-312aa YTCVATNKLGNTNASITLY), identical to the related rat and mouse sequences, Application: IHC-P
Description:
PERK Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PERK(163-176aa QWDQDRESMETVPF), Application: Western Blot
Description:
SOCS3 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SOCS3(71-85aa RDSSDQRHFFTLSVK), identical to the related mouse sequence
Description:
IFNGR1/Cd119 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa), Synonym: IFNGR1, Application: WB, Size:100ug
Description:
Eph receptor B3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Eph receptor B3(982-998aa SIQDMRLQMNQTLPVQV).
Description:
DR4 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DR4(110-125aa TIKLHDQSIGTQQWEH).Application: WB
Description:
CD244 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD244(357-370aa RLSRKELENFDVYS), Application: Western Blot, IHC-P
Description:
TIAM1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus of human TIAM1 (1518-1554aa), Synonyms: TIAM-1; TIAM1;, Application: WB, size: 100ug/vial
Description:
SAPK4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4(343-360aa YKEIVNFSPIARKDSRRR)
Print…
List View
Easy View
