Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology


3,397  results were found
Antibodies

IgGy Antibody Selector – Quickly search hundreds of thousands of antibodies available for purchase from VWR by selecting common antibody features like antigen symbol and name, reactivity, clonality, conjugation, host, and other key factors. Antibodies used to identify and locate intracellular and extracellular proteins in common applications such as Western Blot, ELISA, ImmunoChemistry and Flow Cytometry are all available for your research.


SearchPresentationType-HORIZONTAL
Choose from the options below to refine your search. Multiple selections within any drop-down menu can be made. Click OK to update your results
 
 
SearchResultCount:"3397"
  List View Searching Easy View Easy View
Sort by:
 
 
 
 

Catalog Number: (76466-206)

Supplier:  Boster Biological Technology
Description:   BRE2 Polyclonal Antibody, Host: Rabbit, Reactivity: Yeast, Size: 500ul/vial
Catalog Number: (76174-416)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Zinc finger protein AEBP2(AEBP2) detection. Tested with WB in Human.

Supplier:  Boster Biological Technology
Description:   FITC conjugated goat human IgM secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.25mg
Catalog Number: (10206-868)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: (10207-464)

Supplier:  Boster Biological Technology
Description:   Polyclonal antibody for GFAP detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. GFAP information: Molecul...
Catalog Number: (76174-774)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ZAP-70(ZAP70) detection. Tested with WB, IHC-P in Human.
Catalog Number: (10206-906)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Interleukin-2 receptor subunit alpha(IL2RA) detection. Tested with WB, IHC-P in Human.
Catalog Number: (10207-332)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for NT-3 growth factor receptor(NTRK3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: (10206-748)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Bcl-2-related protein A1(BCL2A1) detection. Tested with WB in Human.
Catalog Number: (76173-582)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Glutamate receptor ionotropic, NMDA 2C(GRIN2C) detection. Tested with WB in Human;Rat.
Catalog Number: (10206-502)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Myoglobin(MB) detection. Tested with WB in Human.

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: (10206-742)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Eukaryotic translation initiation factor 2 subunit 1(EIF2S1) detection. Tested with WB, IHC-P in Human.
Catalog Number: (76464-198)

Supplier:  Boster Biological Technology
Description:   CD30/Tnfrsf8 Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived mouse CD30/Tnfrsf8 recombinant protein (Position: D22-Q272), Alternative Names: CD30/TNFRSF8, CD30 antigen, CD30, CD30KI-1, CD30L receptor, Applications: WB, Size: 100ug/vial

Supplier:  Boster Biological Technology
Description:   HnRNP A2B1/HNRNPA2B1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human hnRNP A2B1 (KTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKL). Alternative Names: hnRNP A2B1, DKFZp779B0244, Applications: WB, Size: 100ug/vial
Catalog Number: (10207-092)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 11(PTPN11) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
209 - 224  of 3,397
Prev   14  15  16  17  18  19  20  21  22  23  24  25  26  27  28  29  Next