Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Sandwich Picokine* ELISA kit of quantitative detection for mouse Cathepsin B Immunogen: NSO, H18-F339 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 5 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10208-792
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-838
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Annexin VIII polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VIII(445-460aa TRSEIDLVQIKQMFAQ)
Catalog Number: 10209-266
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Syndecan 3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Syndecan 3(45-60aa AQRWRNENFERPVDLE).
Catalog Number: 10206-422
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   E2F3 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human E2F3 (278-320aa), Synonym: Transcription factor E2F3, E2F-3, E2F3, KIAA0075, Application: WB, Size:100ug
Catalog Number: 76171-708
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TSLP Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE), Synonym: Thymic stromal lymphopoietin, Thymic stroma-derived lymphopoietin, Tslp, Application: WB, Size:100ug
Catalog Number: 76171-312
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76465-272
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Annexin A3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence in the middle region (153-184aa), Synonyms: Annexin A3;, Application: WB, size: 100ug/vial
Catalog Number: 76173-672
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FABP2/I-FABP PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 31.2pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-508
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   C-Myb Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human c-Myb recombinant protein (M1-E201), Synonyms: Transcriptional activator Myb; Proto-oncogene c-Myb; MYB, Application: WB, size: 100ug/vial
Catalog Number: 76173-410
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   ARF6 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human ARF6 recombinant protein, Synonym: ADP-ribosylation factor 6, ARF6, Application: Western blot, Size: 100ug/vial
Catalog Number: 76174-788
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CA IV Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human CA IV recombinant protein, Synonym: Carbonic anhydrase 4, 4.2.1.1, Carbonate dehydratase IV, Carbonic anhydrase IV, CA-IV, CA4, Application: WB, Size:100ug
Catalog Number: 76171-458
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Gamma Catenin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human gamma Catenin recombinant protein (M556-A745), Synonyms: Junction plakoglobin; Catenin gamma, Application: WB, size: 100ug/vial
Catalog Number: 76173-238
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TLR1 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TLR1, Application: WB.
Catalog Number: 10210-000
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   SP3 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 569-599aa NTNDLTHLRVQVVDEEGDQQHQEGKRLRRVA, Synonyms: Transcription factor Sp3, SPR-2, SP3, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-884
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Bid Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E.coli-derived mouse Bid recombinant protein (Position: M1-D195, Synonym: BH3-interacting domain death agonist, p22 BI, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-142
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
161 - 176  of 6,137
Prev   11  12  13  14  15  16  17  18  19  20  21  22  23  24  25  26  Next