Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   ABR Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa), Synonym: ABR, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-406
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PDPK1/Pdk 1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ, Synonyms: phosphoinositide-dependent protein kinase 1, hPDK1, Size: 100ug/vial
Catalog Number: 76174-286
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-102
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MCP-1, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived human MCP-1 recombinant protein, Synonyms: HC11, Monocyte chemoattractant protein 1, Application: Western blot, ELISA, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76173-996
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-154
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IGFBP3 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human IGFBP3(182-198aa IKKGHAKDSQRYKVDYE).Application: WB, IHC-P
Catalog Number: 10208-032
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   HSP70 antibody, monoclonal, Clone: SJ-70, Host: Mouse, Isotype: IgG, Species reactivity: Human, Immunogen: HSP70 isolated from bovine brain.Application: WB, IHC-P, IHC-F
Catalog Number: 10207-946
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Dnmt1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Dnmt1 recombinant protein (Position: D22-N126), Synonym: DNA (cytosine-5)-methyltransferase 1, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76170-836
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CYP2U1 antibody, Polyclonal, Host: Rabbit IgG, Synonyms: CP2U1_HUMAN antibody, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CYP2U1(457-473aa EKPEDFYPNRFLDDQGQ). Application: IHC-P, ICC, WB
Catalog Number: 10206-740
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-578
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SLC30A4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SLC30A4(407-427aa TIQLQSYRQEVDRTCANCQSS)
Catalog Number: 10209-490
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   LTK antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LTK(850-864aa RGLQPQNLWNPTYRS).Application: WB
Catalog Number: 10208-842
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-634
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   RPL19/Ribosomal Protein L19 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a the C-terminus (132-170aa), Synonyms: RPL19, Application: WB, size: 100ug/vial
Catalog Number: 76173-098
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Abhd5 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human Abhd5 recombinant protein (R169-D349), Synonyms: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5; 2.3.1.51, Application: WB, size: 100ug/vial
Catalog Number: 76172-924
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Lipocalin-2/NGAL, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived rat Lipocalin 2 recombinant protein, Synonyms: Alpha-2U globulin-related protein, Application: WB, IHC-P, IHC-F, ELISA, Size: 100ug/vial
Catalog Number: 76174-074
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
225 - 240  of 6,135
Prev   15  16  17  18  19  20  21  22  23  24  25  26  27  28  29  30  Next