Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology


6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"6137"
  List View Searching Easy View Easy View
Sort by:
 
 
 
 

Catalog Number: (10206-704)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 2(IDO2) detection. Tested with WB in Human.

Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of Dog Caninea Neurotrophin-3

Supplier:  Boster Biological Technology
Description:   BMP5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) Alternative Names: BMP-5, BMP5, Size: 50ug/vial
Catalog Number: (76174-778)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human;Rat.
Catalog Number: (76465-084)

Supplier:  Boster Biological Technology
Description:   Collagen XVII/COL17A1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of Collagen XVII/COL17A1, Alternative Names: Collagen XVII, 180 kDa bullous pemphigoid antigen 2, BA16H23.2, BP180, Size: 100ug/vial
Catalog Number: (76173-112)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Synapsin-1(SYN1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: (76463-692)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for SPR detection. Tested with WB, Direct ELISA in Human;Mouse.
Catalog Number: (76172-920)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for 4-aminobutyrate aminotransferase, mitochondrial(ABAT) detection. Tested with WB in Human;Mouse;Rat.
Catalog Number: (76173-068)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human;Rat.
Catalog Number: (76174-952)

Supplier:  Boster Biological Technology
Description:   Polyclonal antibody for Livin/BIRC7 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: ELISA. Reactive species: Human. Livin/BIRC7 inform...
Catalog Number: (76464-932)

Supplier:  Boster Biological Technology
Description:   RNA Helicase A Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived RNA Helicase A/DHX9 recombinant protein, Alternative Names: RNA Helicase A, DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, Size: 100ug/vial
Catalog Number: (76173-842)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Complement decay-accelerating factor(CD55) detection. Tested with WB, IHC-P in Human;Mouse.
Catalog Number: (76173-098)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for 60S ribosomal protein L19(RPL19) detection. Tested with WB in Human;Mouse;Rat.

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Mouse Angiopoietin-2

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Mouse CD32/FCGR2b/c
Catalog Number: (10209-048)

Supplier:  Boster Biological Technology
Description:   Sandwich ELISA kit of Quantitative Detection for Mouse TLR2
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32  of 6,137
Prev   2  3  4  5  6  7  8  9  10  11  12  13  14  15  16  17  Next