Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,137  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6137"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Sandwich Picokine* ELISA kit of quantitative detection for human BMP-2 Immunogen: CHO, Q283-R396 Assay range: 62.5pg/ml-4000pg/ml Sensitivity: < 2 pg/ml 96-well plate precoated Sample Type: bone tissue, cell culture supernates and serum.
Catalog Number: 10207-738
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   C-Myc antibody, Monoclonal, Host: Mouse IgG1, Clone number: IMD-3, Synonyms: C-Myc/bHLHe39/Proto-oncogene c-Myc/Transcription factor p64, Reactivity: Human, Immunogen: Synthetic peptide corresponding to residues 408-439 of the human p62c-Myc protein.
Catalog Number: 10206-122
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human BDNF, Immunogen: sf21, H129-R247, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 2 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), 96-well plate precoated
Catalog Number: 10205-698
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-060
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Monkey Primate BMP-2 PicoKine* ELISA Kit, Sensitivity: <2pg/ml, Sample type: bone tissue, cell culture supernates and serum, Species reactivity: Monkey, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Immunogen: Q283-R396, Size: 96wells/kit
Catalog Number: 76171-904
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-426
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich Picokine* ELISA kit of quantitative detection for human Fetuin A Immunogen: NSO, A19-V367 Assay range: 312pg/ml-20, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-668
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-314
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PLK1/Plk Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human PLK1 recombinant protein, Synonyms: erine/threonine-protein kinase PLK1, 2.7.11.21, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-868
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Monkey Primate TGF-Beta 2 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), Species reactivity: Monkey, Assay: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-298
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL-34 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 62.5pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-446
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Human FGF2 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human FGF2 recombinant protein(Position: P143-S288), for Fibroblast growth factor 2(FGF2) detection. Tested with WB, IHC-P, ELISA, Neu, IP in Human
Catalog Number: 10209-328
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PP2A Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PP2A(6-20aa FTKELDQWIEQLNEC), identical to the related rat and mouse sequences, Application: Western Blot, IHC-P
Catalog Number: 10207-082
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MAOA/Monoamine Oxidase A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER, Synonyms: Amine oxidase, Size: 100ug/vial
Catalog Number: 76173-792
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Abl Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: (1020-1049aa ERIASGAITKGVVLDSTEALCLAISRNSEQ, Synonyms: Proto-oncogene c-Abl, p150, ABL1, ABL, JTK7, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76173-758
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PUMA Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PUMA(145-159aa ADDLNAQYERRRQEE), identical to the related rat and mouse sequences, Application: Western Blot
Catalog Number: 10207-126
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1 - 16  of 6,137
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next