Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   ALIX Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human ALIX recombinant protein, Synonyms: Programmed cell death 6-interacting protein, ALIX, KIAA137, Application: WB, Size: 100ug/vial
Catalog Number: 76174-356
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Carbonic Anhydrase I antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Carbonic Anhydrase I(51-68aa SYNPATAKEIINVGHSFH).
Catalog Number: 10206-088
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   LCAT Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR, Synonyms: Phosphatidylcholine-sterol acyltransferase, 2.3.1.43, Application: WB, Size: 100ug/vial
Catalog Number: 76173-778
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Progesterone Receptor antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Progesterone Receptor(536-553aa QVYPPYLNYLRPDSEASQ).
Catalog Number: 10206-046
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   EIF6 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human EIF6 recombinant protein, Synonyms: eIF6, EIF3A, ITGB4BP, OK/SW-cl.27, Application: WB, IHC-P, ICC, Size: 100ug/vial
Catalog Number: 76174-020
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MEF2A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 466-507aa DGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDAW VT, Synonyms: Serum response factor-like protein 1, MEF2A, MEF2, Size: 100ug/vial
Catalog Number: 76174-744
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TREX1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD, Synonyms: 3.1.11.2, 3'-5' exonuclease TREX1, DNase III, TREX1, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76174-312
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   KLF4 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KLF4(93-108aa RRETEEFNDLLDLDFI), identical to the related mouse and rat sequences, Application: Western Blot, IHC-P
Catalog Number: 10207-418
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-912
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CD19 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Immunogen: E. Coli-derived human CD19 recombinant protein (Position: P20-Y259), Synonym: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-822
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   WASP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 129-156aa ADEDEAQAFRALVQEKIQKRNQRQSGDR, Synonyms: Wiskott-Aldrich syndrome protein, WASp, WAS, IMD2, Application: WB, IHC-P, IHC-F, ICC, Size: 100ug/vial
Catalog Number: 76173-748
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ACCN1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus (112-147aa), Synonyms: Acid-sensing ion channel 2; ASIC2, Application: WB, size: 100ug/vial
Catalog Number: 76173-006
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-414
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   E2F6 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human E2F6(162-177aa KDCAQQLFELTDDKEN), different from the related mouse and rat sequences by one amino acid
Catalog Number: 10207-296
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   EBP1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa), Synonym: PA2G4, EBP1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-666
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD80 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD80(57-71aa EELAQTRIYWQKEKK), Application: Western Blot, IHC-P
Catalog Number: 10207-148
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
609 - 624  of 6,135
Prev   39  40  41  42  43  44  45  46  47  48  49  50  51  52  53  54  Next