Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   Picoband*COPE Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human COPE recombinant protein, Synonyms: Coatomer subunit epsilon, Application: IHC-P, WB, Storage: -20 to 4 deg C, Size: 100ug/vial
Catalog Number: 76171-836
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MEKK1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MEKK1(1418-1432aa PEVLRGQQYGRSCDV), identical to the related rat and mouse sequences, Application:, IHC-P
Catalog Number: 10206-944
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-460
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Lysozyme Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ, Synonyms: Lysozyme C, 3.2.1.17, 1,4-beta-N-acetylmuramidase C, LYZ, LZM, Size: 100ug/vial
Catalog Number: 76173-790
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   RbAp48 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS, Synonyms: RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48, Size: 100ug/vial
Catalog Number: 76174-450
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Angiopoietin-2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human Angiopoietin-2 recombinant protein Position: E180-D283, Synonym: Angiopoietin-2, ANG-2, ANGPT2, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76170-990
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   FGF19 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FGF19(124-140aa EEIRPDGYNVYRSEKHR), Application: Western Blot, IHC-P
Catalog Number: 10206-832
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   ANGPTL3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ANGPTL3(32-48aa EPKSRFAMLDDVKILAN), identical to the related rat and mouse sequences.
Catalog Number: 10206-658
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ALDH2 Polyclonal Antibody, Host: Rabbit, Species: Human Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2, different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid
Catalog Number: 10206-988
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CBS Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human CBS recombinant protein, Synonym: Cystathionine beta-synthase, Beta-thionase, Serine sulfhydrase, CBS, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-886
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Frizzled 4 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY), Synonym: FZD4, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-582
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PI 3 Kinase p85 alpha antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PI 3 Kinase p85 alpha(65-80aa ERGDFPGTYVEYIGRK).
Catalog Number: 10206-044
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Alpha Actinin 4 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Alpha Actinin 4 recombinant protein, Synonym: ACTN4, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-410
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-194
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CXCL13/BLC Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse BCA1 recombinant protein, Synonym: C-X-C motif chemokine 13, Application: WB, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76174-858
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TCPTP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human TCPTP recombinant protein, Synonyms: Tyrosine-protein phosphatase non-receptor type 2, 3.1.3.48, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-870
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
769 - 784  of 6,135
Prev   49  50  51  52  53  54  55  56  57  58  59  60  61  62  63  64  Next