Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   IL12B/Il 12 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Rat, Immunogen: E. Coli-derived mouse IL12B recombinant protein (Position: M23-E250), Synonym: CLMF p40, IL-12 subunit p40, Il12b, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-338
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-636
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   ADAM2 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADAM2(701-715aa VLIAIMVKVNFQRKK), Application: Western Blot
Catalog Number: 10206-986
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   STAT1 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human STAT1(736-750aa RIVGSVEFDSMMNTV), Application: Western Blot
Catalog Number: 10206-838
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Thrombopoietin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse Thrombopoietin recombinant protein (Position: S22-H259), Synonym: Thpo, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-724
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   ICAM1 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human ICAM1 recombinant protein (Position: L214-P532). Human ICAM1 shares 52% and 48% amino acid (aa) sequences identity with mouse and rat ICAM1, respectively
Catalog Number: 10209-696
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-282
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   SSR3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SSR3(8-23aa KQQSEEDLLLQDFSRN), identical to the related rat and mouse sequences, Application: Western Blot
Catalog Number: 10207-282
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PIAS4/Piasy Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a the N-terminus (130-174aa), Synonyms: E3 SUMO-protein ligase PIAS4; 6.3.2.-, Application: WB, size: 100ug/vial
Catalog Number: 76173-078
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   SOD3/Ec Sod Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD), Synonym: 1.15.1.1, SOD3, Application: IHC-P, Size:100ug
Catalog Number: 76171-508
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TATA binding protein TBP antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TATA binding protein TBP(227-246aa EEQSRLAARKYARVVQKLGF).
Catalog Number: 10205-968
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL17C Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse IL17C recombinant protein (Position: H15-Q194), Synonym: Interleukin-17C, Il-17c, Cytokine CX2, Il17c, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-830
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-704
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   NOXA1 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NOXA1(176-195aa RQVPRGEVFRPHRWHLKHLE), Application: Western Blot
Catalog Number: 10206-952
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*ACSL5 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5, Synonyms: Long-chain-fatty-acid--CoA ligase 5, Uses: WB, Size: 100ug/vial
Catalog Number: 76171-872
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Bcr Picoband* Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Bcr recombinant protein, Synonym: BCR, BCR1, D22S11, Breakpoint cluster region protein, Application: WB, Size: 100ug/vial
Catalog Number: 76174-836
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
897 - 912  of 6,135
Prev   57  58  59  60  61  62  63  64  65  66  67  68  69  70  71  72  Next