Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   CDK6 antibody, Monoclonal, Host: Mouse IgG, Clone number: IML-6, Synonyms: CDKN6/PLSTIRE/Cell division protein kinase 6/Serine/threonine-protein kinase PLSTIRE, Reactivity: Human, Mouse, Rat, Immunogen: Recombinant human Cdk6 protein. Application: ICC, WB
Catalog Number: 10206-158
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Elafin/PI3 Picoband* Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived human Elafin/Skalp recombinant protein (Position: A61-Q117), Synonym: PI3, WAP3, WFDC14, Application: WB, Size: 100ug/vial
Catalog Number: 76174-752
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Troponin T antibody, Monoclonal, Host: Mouse IgG1, Clone number: TT-98, Synonyms: TNT/TNTF, Reactivity: Chicken, Rabbit, Rat, Immunogen: Troponin T from rabbit skeletal muscle. Application: IHC-P, IHC-F, WB
Catalog Number: 10205-980
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PIAS4 Antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype:IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human E3 SUMO-protein ligase PIAS4(295-310aa HPELCKALVKEKLRLD), for E3 SUMO-protein ligase detection.
Catalog Number: 10205-914
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-162
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Glutaredoxin 2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Glutaredoxin 2(103-119aa EYGNQFQDALYKMTGER)
Catalog Number: 10209-178
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IL6 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL6, Application: WB.
Catalog Number: 10210-044
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-280
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   OGT Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA, Synonyms: O-GlcNAc transferase subunit p110, OGT, OGT, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-350
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   GPX1/Glutathione Peroxidase 1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to sequence in middle region(116-146aa), Synonym: GPx-1, Application: WB, size: 100ug/vial
Catalog Number: 76173-272
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat GM-CSF, Immunogen: E.coli, A1-K127, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-716
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   FOLR2/Beta Fr PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates and serum, Species reactivity: Human, Assay Range: 31.2pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Synonyms: FBP, Size: 96wells/kit
Catalog Number: 76172-680
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human LOX-1/OLR1, Immunogen: NSO, S61-Q273, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human IGFBP-1, Immunogen: NSO, A26-N259, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 1 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and urine, 96-well plate precoated
Catalog Number: 10205-556
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Sandwich PicoKine* ELISA kit of Quantitative Detection for Human P53, Immunogen: NSO, M1-D393, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell lysates, 96-well plate precoated
Catalog Number: 10205-854
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
913 - 928  of 6,135
Prev   58  59  60  61  62  63  64  65  66  67  68  69  70  71  72  73  Next