Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   SCF antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Immunogen: E. coli-derived human SCF recombinant protein(Position: E26-A190), for Kit ligand/Mast cell growth factor(KITLG) detection
Catalog Number: 10209-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-592
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*CD23 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human CD23 recombinant protein (Position: D48-R284), Synonyms: Low affinity immunoglobulin epsilon Fc receptor, BLAST-2, Application: ELISA, WB, Size: 100ug/vial
Catalog Number: 76171-812
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   GFAP Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: E.coli-derived human GFAP recombinant protein (Position: Q93-M432). Human GFAP shares 94% amino acid (aa) sequence identity with both mouse and rat GFAP, Application: Western Blot, IHC-P
Catalog Number: 10207-464
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Abl Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: (1020-1049aa ERIASGAITKGVVLDSTEALCLAISRNSEQ, Synonyms: Proto-oncogene c-Abl, p150, ABL1, ABL, JTK7, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76173-758
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76463-692
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   S100 Alpha 6 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human S100 alpha 6 recombinant protein, Synonyms: Calcyclin, Growth factor-inducible protein 2A9, Size: 100ug/vial
Catalog Number: 76174-168
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Collagen, Type III antibody, monoclonal, Clone: Col-29, Host: Mouse, Isotype: IgG, Species reactivity: Human, mouse, rat, Immunogen: Human collagen type III.Application: WB, IHC-F
Catalog Number: 10207-934
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL12B/Il 12 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived rat IL12B recombinant protein (Position: M23-E250), Synonym: Interleukin-12 subunit beta, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-340
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TRKC Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TrkC(167-182aa DIRWMQLWQEQGEAKL), different from the related mouse and rat sequences by one amino acid, Application:, IHC-P
Catalog Number: 10207-332
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-276
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Bax Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa), Synonym: BAX, BCL2L4, Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76170-724
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   FES antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FES(808-822aa STIYQELQSIRKRHR).Application: WB
Catalog Number: 10208-822
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PDK4 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN, Synonyms: yruvate dehydrogenase kinase isoform 4, Application: WB, Size: 100ug/vial
Catalog Number: 76174-362
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-682
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IL-18 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human IL-18 recombinant protein (Y37-D193), Synonyms: Interleukin-18; IL-18, IL-1 gamma;IL18;IGIF, IL1F4, Application: IHC-P, ICC, Western Blot, size: 100ug/vial
Catalog Number: 76173-136
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
993 - 1,008  of 6,135
Prev   63  64  65  66  67  68  69  70  71  72  73  74  75  76  77  78  Next