Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Aquaporin 9 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Aquaporin 9(263-278aa VLFIQMHHSNPDPEVK). Application: WB
Catalog Number: 10206-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PLAT/TPA Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Immunogen: E.coli-derived human TPA recombinant protein (H366-P562), Synonyms: Tissue-type plasminogen activator;, Form: Lyophilised, Application: WB, size: 100ug/vial
Catalog Number: 76173-524
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-096
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   DISC1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse, Isotype: IgG, A synthetic peptide corresponding to a sequence in the middle region of human DISC1, different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids
Catalog Number: 10206-976
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IL2 antibody, Polyclonal, Host: Rabbit, Reactivity: Mouse, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IL2, Application: WB.
Catalog Number: 10210-022
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   LASP1 antibody, Polyclonal, Host: Rabbit, Reactivity: HumanRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LASP1, Application: IHC-P, WB.
Catalog Number: 10209-968
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Caspase-12 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase-12(71-84aa KIFREHLWNSKKQL). Application: IHC-P, WB
Catalog Number: 10206-416
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-978
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   DGCR8 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human DGCR8 recombinant protein (Position: K561-Q762), Synonym: DGCR8, C22orf12, DGCRK6, LP4941, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-058
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-142
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Apolipoprotein B Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human Apolipoprotein B recombinant protein (Q246-N450), Synonyms: Apolipoprotein B-100; Apo B-100, Application: WB, size: 100ug/vial
Catalog Number: 76172-998
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*IRF9/Isgf 3 Gamma P48 Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human IRF9 recombinant protein, Synonyms: Interferon regulatory factor 9, IRF-9, Application: Western blot, Size: 100ug/vial
Catalog Number: 76171-826
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Galectin-4 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY, Synonyms: Galectin-4, Gal-4, Antigen NY-CO-27, L-36 lactose-binding protein, Size: 100ug/vial
Catalog Number: 76174-742
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SP1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa), Synonym: Transcription factor Sp1, Application: Western blot, Size: 100ug/vial
Catalog Number: 76174-936
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PRKAR1A Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Immunogen: E.coli-derived human PRKAR1A recombinant protein (Position: E2-E81, Synonym: N-terminally processed, PRKAR1A, PKR1, PRKAR1, TSE1, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-132
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IGFBP-1, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: 177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA, Synonyms: IBP-1, IGF-binding protein 1, IGFBP-1, Igfbp1, Igfbp-1, Application: Western Blot, ELISA, Size: 100ug/vial
Catalog Number: 76174-064
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1,393 - 1,408  of 6,135
Prev   88  89  90  91  92  93  94  95  96  97  98  99  100  101  102  103  Next