Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Catalog Number: 76465-368
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*IL1F10/Il 38 Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human IL1F10 recombinant protein (Position: M1-W152), Synonyms: Interleukin-1 family member 10, Application: ELISA, IHC-P, WB, Size: 100ug/vial
Catalog Number: 76172-026
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-626
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76466-264
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CD152, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Synonym: Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, CTLA4, CD152, Form: Lyophilized, Application: IHC, Size:100ul
Catalog Number: 76170-746
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   HCG receptor polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human hCG receptor(127-143aa YLSICNTGIRKFPDVTK)
Catalog Number: 10209-254
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TRPM5 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human TRPM5 recombinant protein, Synonyms: Transient receptor potential cation channel subfamily M member 5, Size: 100ug/vial
Catalog Number: 76174-646
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Cathepsin D Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human Cathepsin D recombinant protein (Position: G65-L412), Human Cathepsin D shares 85% amino acid (aa)
Catalog Number: 10209-274
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-944
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Involucrin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK, Synonyms: Involucrin, IVL, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76174-240
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Kv1.4 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK, Synonyms: Voltage-gated potassium channel subunit Kv1.4, KCNA4, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-470
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   P-Selectin Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human CD62P recombinant protein (W42-G271), Synonyms: P-selectin; CD62 antigen-like family member P, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-560
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PKR antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PKR(2-18aa AGDLSAGFFMEELNTYR).Application: WB
Catalog Number: 10208-850
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-402
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-258
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76465-910
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1,425 - 1,440  of 6,135
Prev   90  91  92  93  94  95  96  97  98  99  100  101  102  103  104  105  Next