MilliporeSigma
Catalog Number:
(EMOP64-20UG)
Supplier:
MilliporeSigma
Description:
Primary mouse Anti-p21 WAF1 (Ab-1) (EA10) reacts with human.
Catalog Number:
(EMOP43-20UG)
Supplier:
MilliporeSigma
Description:
Primary mouse Anti-p53 (Ab-6) (Pantropic) (DO-1) reacts with cat (Feline), human.
Catalog Number:
(EMOP33-20UG)
Supplier:
MilliporeSigma
Description:
Primary Mouse Anti-p53 (Ab-5) (Wild type) (PAb1620) Reacts with cow (bovine, cattle), human, mouse, primate, rat.
Catalog Number:
(80056-536)
Supplier:
MilliporeSigma
Description:
This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQEL...
Catalog Number:
(EMOP29-200UG)
Supplier:
MilliporeSigma
Description:
Primary Mouse Anti-p53 (Ab-3) (Mutant) (PAb240) reacts with chicken, cow (bovine, cattle), hamster, human, mouse, aat.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||