Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

MilliporeSigma


5  results were found
Antibodies

IgGy Antibody Selector – Quickly search hundreds of thousands of antibodies available for purchase from VWR by selecting common antibody features like antigen symbol and name, reactivity, clonality, conjugation, host, and other key factors. Antibodies used to identify and locate intracellular and extracellular proteins in common applications such as Western Blot, ELISA, ImmunoChemistry and Flow Cytometry are all available for your research.


SearchPresentationType-HORIZONTAL
Choose from the options below to refine your search. Multiple selections within any drop-down menu can be made. Click OK to update your results
 
 
SearchResultCount:"5"
  List View Searching Easy View Easy View
Sort by:
 
 
 
 


Supplier:  MilliporeSigma
Description:   Primary mouse Anti-p21 WAF1 (Ab-1) (EA10) reacts with human.
Catalog Number: (EMOP43-20UG)

Supplier:  MilliporeSigma
Description:   Primary mouse Anti-p53 (Ab-6) (Pantropic) (DO-1) reacts with cat (Feline), human.
Catalog Number: (EMOP33-20UG)

Supplier:  MilliporeSigma
Description:   Primary Mouse Anti-p53 (Ab-5) (Wild type) (PAb1620) Reacts with cow (bovine, cattle), human, mouse, primate, rat.
Catalog Number: (80056-536)

Supplier:  MilliporeSigma
Description:   This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQEL...
Catalog Number: (EMOP29-200UG)

Supplier:  MilliporeSigma
Description:   Primary Mouse Anti-p53 (Ab-3) (Mutant) (PAb240) reacts with chicken, cow (bovine, cattle), hamster, human, mouse, aat.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 5  of 5