Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
You Searched For:

Promega Corporation

3,085  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"3085"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   Recognition/cut site: C//CATGG. Size: 200 units. The following assays assure purity or activity: activity determination assay, overdigestion assay, and ligation assay. Blue/white cloning qualified. With a tube of acetylated BSA. Re-assayed every 3-6 months.
Catalog Number: PAR6513
Supplier: Promega Corporation



Quantity:
 
 
 
Certificate Certificates    
Product Image
Catalog Number: PAV8870
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   PNLCoI2[luc2-P2A-NlucP/minP/Hygro] Vector, Coincidence Reporter Vector, For: Features: Improve Confidence and Save Time, Employ Robust and Sensitive Reporter Pair, Efficiently Identify False Hits, Use Simple Detection Format, Storage: -20 deg C, size: 20 ug
Catalog Number: PAN1471
Supplier: Promega Corporation



Quantity:
 
 
 
Certificate Certificates    
Vendor Image
Description:   NUAK2 Kinase Enzyme System, Easily Screen and Profile NUAK2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Catalog Number: PAV5096
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS    
Product Image
Description:   Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
Catalog Number: PAV9681
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   Recombinant human HIPK3 (163–562) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. JNK regulates the expression of HIPK3 in prostate cancer cells and this contributes to increased resistance to Fas receptor-mediated apoptosis.
Catalog Number: PAV4164
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.
Catalog Number: PAV4245
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   NanoBRET* Nano-Glo* Detection System, Features: Understand Real Biology, Monitor Changes, See Improved Assay Performance, Scale Your Assays, Enjoy Convenience, Storage: -30 deg C to -10 deg C, protected from light, size: 10, 000 assays
Catalog Number: PAN1663
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Product Image
Description:   VECTOR PGL 4.43 [LUC2P/XRE/HYGRO] 20UG
Catalog Number: PAE4121
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Product Image
Description:   Substrate: Poly (4:1 Glu, Tyr) Peptide.
Catalog Number: PAV9761
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   Pyk2 Kinase Enzyme System, Easily Screen and Profile Pyk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Catalog Number: PAV6477
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS    
Vendor Image
Description:   Msk2 Kinase Enzyme System, Easily Screen and Profile Msk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Catalog Number: PAV6591
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS    
Product Image
Description:   Recombinant full-length human PKC? was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Protein Kinase C theta (PKC?) is an important component in the intracellular signaling cascade
Catalog Number: PAV4040
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Catalog Number: PAC8441
Supplier: Promega Corporation



Quantity:
 
 
 
   
Product Image
Description:   Akt2 Kinase Enzyme Easily Screen and Profile AKT2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Catalog Number: PAV3862
Supplier: Promega Corporation



Quantity:
 
 
 
MSDS SDS    
Product Image
Description:   PHAb Thiol Reactive Dye, pH sensor dye, low fluorescence at pH > 7 and a dramatic increase in fluorescence as the pH of the solution becomes acidic, excitation maxima (Ex) at 532nm and emission maxima (Em) at 560nm, designed specifically for antibody labeling, Size:4x 250ug
Catalog Number: PAG9835
Supplier: Promega Corporation



Quantity:
 
 
 
Certificate Certificates    
Items Per Page: 16  32  64 
33 - 48  of 3,085
Prev   3  4  5  6  7  8  9  10  11  12  13  14  15  16  17  18  Next