Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
So much has changed during this unprecedented time, except your ability to count on Avantor. We continue to set science in motion to create a better world by providing you with the right solutions to keep moving forward.
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
Avantor supports end-to-end fluid management solutions – including peristaltic pumps and aseptic fluid transfer solutions – that are reliable and customer-centric, helping bioprocessing manufacturers meet their research and production goals.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
New Avantor® J.T.Baker® premium conductive and non-conductive robotic tips deliver superior quality and reliable performance for results you can trust.
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
Description:
IRAK4 Kinase Enzyme System, Recombinant full-length human IRAK4 expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag, nterleukin-1 receptor-associated kinase 4 (IRAK4) is an important mediator in the signal transduction, Storage: -70 deg C, Size: 1 mg
Description:
Was expressed by baculovirus in sf9 insect cells using an n-terminal gst tag. akt1/pkb? is a serine/threonine kinase that belongs to the akt family.
Description:
Msk1 Kinase Enzyme System, Easily Screen and Profile Msk1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
ADP-Glo* Kinase Assay with PIP2:3PS, Features: Employ Complete Solutions for Class I PI3Ks, Observe Excellent Selectivity, Obtain Reliable Results, Save Time, Avoid False Hits, size: 10, 000 assays
Description:
Recombinant full-length human AMPK (combination of A2/B1/G1 subunits) was expressed by baculovirus in Sf9 insect cells using a C-terminal His tag. It plays a key role in insulin signaling pathway and is a major therapeutic target for the treatment of diabetes.
Description:
MlCK Kinase Enzyme System, Easily Screen and Profile mlCK Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
ERK1 Kinase Enzyme Easily Screen and Profile ERK1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
Grk5 Kinase Enzyme Easily Screen and Profile GRK5 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
AKT1 Kinase Enzyme System, Expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag, Involved in glucose metabolism, transcription, survival, cell proliferation, angiogenesis, cell motility, Active in many types of human cancers, Storage: -70 deg C, Size: 1 mg
Description:
Clk1 Kinase Enzyme System, Easily Screen and Profile Clk1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Cmgc-2 Kinase Selectivity Profiling System, Selectivity Screening of Library Compounds for Effect on Tyrosine Kinases, Kinase and substrate pairs organized in an easy-to-use 8-tube strip format, With ADP-Glo* Assay, Size: 8x50reaction
Description:
Rock2 Kinase Enzyme System, Easily Screen and Profile Rock2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
HDAC-Glo* I/II Assay, single-reagent-addition, homogeneous, luminescent assays that measure the relative activity of histone deacetylase (HDAC) class I and II enzymes from cells, extracts or purified enzyme sources, acetylated, luminogenic peptide substrate, Size:100ml
Description:
Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle.
Description:
IKKB Kinase Enzyme System, with ADP-Glo* Assay, Easily Screen and Profile IKKB Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
MRCK alpha Kinase Enzyme System, Easily Screen and Profile MRCK alpha Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
AURORA A Kinase Enzyme Easily Screen and Profile AURORA A Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
SRC Kinase Enzyme System, Recombinant full-length human SRC was expressed in E. coli cells using an N-terminal GST tag, identified as a transforming protein of the Rous sarcoma virus, overexpressed and activated in human malignancies, Storage: -70 deg C, Size: 1 mg
Description:
PGL4.36[luc2P/MMTV/Hygro] Vector, Nuclear Receptor Analysis Luciferase, can be performed with traditional means by using a minimal promoter vector with nuclear receptor response elements upstream, Robust, More Sensitive, Adaptable, Consistent, Faster Results, size: 20ug
Description:
Hipk3 Kinase Enzyme System, Easily Screen and Profile Hipk3 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
CDC7/DBF4 Kinase Enzyme System, Easily Screen and Profile CDC7/DBF4 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
P450-Glo* CYP2B6 Screening Systems, includes complete set of reagents, Luminescent format eliminates need for time-consuming analyses, Broad dynamic range and low background, assay employs luminogenic P450 substrates, Size: 1000 assays
Description:
Recognition/cut site: C//CATGG. Size: 200 units. The following assays assure purity or activity: activity determination assay, overdigestion assay, and ligation assay. Blue/white cloning qualified. With a tube of acetylated BSA. Re-assayed every 3-6 months.
Description:
PNLCoI2[luc2-P2A-NlucP/minP/Hygro] Vector, Coincidence Reporter Vector, For: Features: Improve Confidence and Save Time, Employ Robust and Sensitive Reporter Pair, Efficiently Identify False Hits, Use Simple Detection Format, Storage: -20 deg C, size: 20 ug
Description:
NUAK2 Kinase Enzyme System, Easily Screen and Profile NUAK2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
Description:
Recombinant human HIPK3 (163–562) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. JNK regulates the expression of HIPK3 in prostate cancer cells and this contributes to increased resistance to Fas receptor-mediated apoptosis.
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.
Description:
Pyk2 Kinase Enzyme System, Easily Screen and Profile Pyk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Msk2 Kinase Enzyme System, Easily Screen and Profile Msk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Recombinant full-length human PKC? was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Protein Kinase C theta (PKC?) is an important component in the intracellular signaling cascade
Description:
Akt2 Kinase Enzyme Easily Screen and Profile AKT2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
PHAb Thiol Reactive Dye, pH sensor dye, low fluorescence at pH > 7 and a dramatic increase in fluorescence as the pH of the solution becomes acidic, excitation maxima (Ex) at 532nm and emission maxima (Em) at 560nm, designed specifically for antibody labeling, Size:4x 250ug
Description:
Pkc Theta Kinase Enzyme System, Easily Screen and Profile Pkc Theta Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
MSK2 Kinase Enzyme, Easily Screen and Profile MSK2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
For labeling in vitro, transcription in vitro. Concentration: 80units/uL. Size: 2500 units. Packaged in a tamper evident, clear plastic sealed packet that contains the enzyme tube, its buffer(s) and a lot-specific Promega* Product Information insert. 24-month lifetime.
Description:
NanoLuc* (Nluc) luciferase (19.1kDa) enzyme. For luminescent reporting using furimazine to produce high intensity, glow-type luminescence. The luminescent reaction is ATP-independent and designed to suppress background luminescence for maximal assay sensitivity.
Description:
Ret (V804L) Kinase Enzyme System, Easily Screen and Profile Ret (V804L) Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Store at -20[degree]C. The pGEM Express Positive Control Template may be used to monitor the pGEM Express Systems and the Riboprobe Systems. The pGEM Express Positive Control Template was constructed by linearizing the pGEMEX-1 Vector with Sca I.
Description:
Pdgfr Alpha (D842V) Kinase Enzyme System, Easily Screen and Profile Pdgfr Alpha (D842V) Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Recombinant mouse epha1 (amino acids 569-end) expressed by baculovirus in sf9 insect cells using an n-terminal GST tag. EPHA1 is a member of the eph family of receptor tyrosine kinases that have been implicated in mediating developmental events, Size: 1 mg
Description:
Modifying enzyme. Labeling in vitro, sequencing, mapping, mutagenesis, duplex shortening. 150-200 units/uL. Size: 25000 units. In a tamper-evident, clear plastic sealed packet with enzyme tube, its buffer(s) and a lot-specific Promega* Product Information insert. 24-month lifetime.
Description:
PGL4.39[Luc2P/Atf6 Re/Hygro] Vector, Signaling Pathway Analysis (Minimal Promoter-Driven) Firefly Luciferase, Optimized For Expression In Mammalian Cells, report the activity of a variety of pathways using the optimized luc2 firefly luciferase gene in the PGL4 backbone, size: 20ug
Description:
Ck1 Gamma 1 Kinase Enzyme System, Easily Screen and Profile Ck1 Gamma 1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Print…
List View
Easy View
