Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
So much has changed during this unprecedented time, except your ability to count on Avantor. We continue to set science in motion to create a better world by providing you with the right solutions to keep moving forward.
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
Avantor supports end-to-end fluid management solutions – including peristaltic pumps and aseptic fluid transfer solutions – that are reliable and customer-centric, helping bioprocessing manufacturers meet their research and production goals.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
New Avantor® J.T.Baker® premium conductive and non-conductive robotic tips deliver superior quality and reliable performance for results you can trust.
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
Description:
Hipk3 Kinase Enzyme System, Easily Screen and Profile Hipk3 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
CDC7/DBF4 Kinase Enzyme System, Easily Screen and Profile CDC7/DBF4 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
NanoLuc* (Nluc) luciferase (19.1kDa) enzyme. For luminescent reporting using furimazine to produce high intensity, glow-type luminescence. The luminescent reaction is ATP-independent and designed to suppress background luminescence for maximal assay sensitivity.
Description:
PNLCoI1[luc2-P2A-NlucP/Hygro] Vector, Coincidence Reporter Vector, For: Features: Improve Confidence and Save Time, Employ Robust and Sensitive Reporter Pair, Efficiently Identify False Hits, Use Simple Detection Format, Storage: -20 deg C, size: 20 ug
Description:
CDK5/P25 Kinase Enzyme Easily Screen and Profile CDK5/P25 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
Rock2 Kinase Enzyme System, Easily Screen and Profile Rock2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
GloMax* 20/20 Replacement Tubing (2), Valves (4), Tips (30), GloMax* 20/20 Luminometer, combines instrumentation and software in a complete solution that includes bioluminescent assays, protocols and support, ultrasensitive, versatile and affordable luminometer
Description:
HDAC-Glo* I/II Assay, single-reagent-addition, homogeneous, luminescent assays that measure the relative activity of histone deacetylase (HDAC) class I and II enzymes from cells, extracts or purified enzyme sources, acetylated, luminogenic peptide substrate, Size:100ml
Description:
Recombinant full-length human SLK was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Inhibition of SLK activity by dominant-negative mutant or RNAi leads to unfocused microtubule arrangement indicating it is needed for microtubule organization.
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.
Description:
Substrate: PDKtide ([protein fragment, 39 aa]); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
Description:
Recombinant human HIPK3 (163–562) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. JNK regulates the expression of HIPK3 in prostate cancer cells and this contributes to increased resistance to Fas receptor-mediated apoptosis.
Description:
Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle.
Description:
IKKB Kinase Enzyme System, with ADP-Glo* Assay, Easily Screen and Profile IKKB Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Print…
List View
Easy View
