Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
You Searched For:

Anaspec Inc


1,946  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"1946"
  List View Searching Easy View Easy View
Sort by:
 
 
 
 

Catalog Number: (103006-422)

Supplier:  Anaspec Inc
Description:   This peptide corresponds to the protein transduction domain of the TAT protein. In some studies this has been used as a PKCε inhibitor peptide and als...
Catalog Number: (103007-838)

Supplier:  Anaspec Inc
Description:   This is peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, S...
Catalog Number: (103009-734)

Supplier:  Anaspec Inc
Description:   TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain...
Catalog Number: (103007-226)

Supplier:  Anaspec Inc
Description:   This peptide is derived from residues 14-21 of protein kinase C C2 (εPKC C2). This peptide specifically inhibits εPKC by disrupting PKC bi...

Supplier:  Anaspec Inc
Description:   Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and ...

Supplier:  Anaspec Inc
Description:   HiLyte™ Fluor 405 is a blue fluorescent dye with Ex/Em = 404/428 nm, spectrally similar to Alexa Fluor™ 405 and DyLight Fluor™ 405 dyes.
Catalog Number: (103007-788)

Supplier:  Anaspec Inc
Description:   This peptide is derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate.
Sequence: DRVYIHPFHLLYYS
MW: 1...
Catalog Number: (103006-054)

Supplier:  Anaspec Inc
Description:   A more potent suppressor of neuronal cell death than humanin (HN), 10nM of this Gly14 substituted HN blocked cytotoxicity compared to 10uM of HN....
Catalog Number: (103006-034)

Supplier:  Anaspec Inc
Description:   Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irr...
Catalog Number: (103007-256)

Supplier:  Anaspec Inc
Description:   This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAII...
Supplier:  Anaspec Inc
Description:   This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular We...
Catalog Number: (103008-030)

Supplier:  Anaspec Inc
Description:   This peptide is Histone H3 amino acid residues 23 to 34 mono-methylated at Lys-27.
Sequence:KAAR-K(Me1)-SAPATGG
MW:1128.3 Da
% peak are...
Catalog Number: (102996-098)

Supplier:  Anaspec Inc
Description:   Fibrinopeptide A is a 16-amino acid cleavage product of thrombin-induced proteolytic cleavage of fibrinogen. Liberation of FPA and another 14-amino ac...
Supplier:  Anaspec Inc
Description:   The damage of cell membrane leads to the release of cytoplasmic enzymes

Supplier:  Anaspec Inc
Description:   Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety pept...
Supplier:  Anaspec Inc
Description:   Oxytocin (OT) is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in ...
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
209 - 224  of 1,946
Prev   14  15  16  17  18  19  20  21  22  23  24  25  26  27  28  29  Next