Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
You Searched For:

Anaspec Inc


1,946  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"1946"
  List View Searching Easy View Easy View
Sort by:
 
 
 
 

Supplier:  Anaspec Inc
Description:   This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular We...
Catalog Number: (103006-578)

Supplier:  Anaspec Inc
Description:   This peptide is derived from the human mucin MUC5AC gene sequence. Data suggest that MUC5A and MUC5C are part of the same gene MUC5AC, which is distin...
Catalog Number: (103008-326)

Supplier:  Anaspec Inc
Description:   This peptide is Histone H3 (1-21). It is monomethylated at lysine 18 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >9...

Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-38) with phenylalanine and isoleucine universally labeled with 13C. Ab is found in amyloid deposits of Alzheimer’s pat...
Catalog Number: (103007-788)

Supplier:  Anaspec Inc
Description:   This peptide is derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate.
Sequence: DRVYIHPFHLLYYS
MW: 1...
Catalog Number: (103006-422)

Supplier:  Anaspec Inc
Description:   This peptide corresponds to the protein transduction domain of the TAT protein. In some studies this has been used as a PKCε inhibitor peptide and als...

Supplier:  Anaspec Inc
Description:   Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and ...
Catalog Number: (103007-838)

Supplier:  Anaspec Inc
Description:   This is peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, S...

Supplier:  Anaspec Inc
Description:   HiLyte™ Fluor 405 is a blue fluorescent dye with Ex/Em = 404/428 nm, spectrally similar to Alexa Fluor™ 405 and DyLight Fluor™ 405 dyes.
Catalog Number: (103010-856)

Supplier:  Anaspec Inc
Description:   TAMRA-X contains a seven-atom aminohexanoyl spacer (known as ‘X’) between TAMRA fluorophore and the succinimidyl ester. The ‘X’ spacer separates the f...
Supplier:  Anaspec Inc
Description:   M-13 is a peptide that represents CAM-binding domain of Calmodulin (CaM) target proteins. CaM is an ubiquitous Ca2+ binding protein.
Sequence:KRR...
Supplier:  Anaspec Inc
Description:   Oxytocin (OT) is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in ...
Catalog Number: (103006-568)

Supplier:  Anaspec Inc
Description:   This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement syst...
Catalog Number: (103006-034)

Supplier:  Anaspec Inc
Description:   Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irr...
Supplier:  Anaspec Inc
Description:   Although the mixed TAMRA isomers are predominantly used for labeling proteins, the single isomers are increasingly preferred for labeling peptides and...
Catalog Number: (102971-774)

Supplier:  Anaspec Inc
Description:   It is one of the active peptide fragments resulting from maturation of preproapelin. Apelin family of peptides and receptor has been potentially indic...
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240  of 1,946
Prev   15  16  17  18  19  20  21  22  23  24  25  26  27  28  29  30  Next