Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76464-992
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-446
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-080
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-814
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   DDB1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human DDB1 recombinant protein, Synonyms: Xeroderma pigmentosum group E-complementing protein, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-012
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-332
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IKK gamma antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse IKK gamma(1-15aa MNKHPWKNQLSEMVQ), different from the relative rat sequence by three amino acids.
Catalog Number: 10206-556
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Caspase 3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human Caspase 3(207-220aa RNSKDGSWFIQSLC).
Catalog Number: 10206-506
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Ki67 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Ki67(3234-3256aa KKAEDNVCVKKIRTRSHRDSEDI).Application: WB
Catalog Number: 10208-188
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   EPO Receptor Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human EPO Receptor recombinant protein (Position: E48-E226), Synonym: Erythropoietin receptor, EPO-R, EPOR, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-030
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   NR3C2/Mineralocorticoid Receptor Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK, Application: WB, Size: 100ug/vial
Catalog Number: 76174-346
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PIM1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (373-404aa), Synonyms: Serine/threonine-protein kinase pim-1; 2.7.11.1; PIM1, Application: WB, size: 100ug/vial
Catalog Number: 76173-464
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Mouse IL10 Polyclonal antibody, Host: Rabbit, Species Reactivity: Mouse, isotype: IgG, E. coli-derived mouse IL-10 recombinant protein(Position: S19-S178), for Interleukin-10(IL10) detection. Tested with WB, ELISA in Mouse
Catalog Number: 10209-332
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-412
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   BMP-2, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND, Synonyms: Bone morphogenetic protein 2, BMP-2, Bone morphogenetic protein 2A, Application: WB, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76174-190
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Caspase-6(P18) antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat Caspase-6(P18)(7-27aa FYRSREVLDPAEQYKMDHKRR).
Catalog Number: 10206-324
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
321 - 336  of 6,135
Prev   21  22  23  24  25  26  27  28  29  30  31  32  33  34  35  36  Next