Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   TREX2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human TREX2 recombinant protein(E69-A279), Synonym: Three prime repair exonuclease 2; 3.1.11.2; 3'-5' exonuclease TREX2, Application: WB, size: 100ug/vial
Catalog Number: 76173-124
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Patched/PTCH1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Patched recombinant protein (D1219-N1447), Synonyms: PTC; PTC1; PTCH1; PTCH, Application: WB, size: 100ug/vial
Catalog Number: 76173-538
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   BDKRB2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa), Synonyms: B2 bradykinin receptor; B2R, Application: WB, size: 100ug/vial
Catalog Number: 76173-008
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Leupaxin polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Leupaxin(115-129aa KKHLPDKQDHKASLD), different from the related rat sequence by two amino acids
Catalog Number: 10209-448
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Galectin 8 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW, Synonyms: Galectin-8, Gal-8, Po66 carbohydrate-binding protein, Application: WB, Size: 100ug/vial
Catalog Number: 76173-782
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   WASP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 45-74aa NLLTDSKSLQLVLEPSLQLLSRKQRRLIRQ), Synonyms: Proto-oncogene Wnt-1, Proto-oncogene Int-1 homolog, WNT1, INT1, Application: WB, Size: 100ug/vial
Catalog Number: 76172-982
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-318
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TRKA Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse TrkA(71-90aa LYVENQQHLQRLEFEDLQGL), different from the related rat sequence by two amino acids
Catalog Number: 10207-406
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-550
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-600
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SIRT3/Sirtuin 3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human SIRT3 recombinant protein (P66-K399), Synonyms: mitochondrial; hSIRT3; 3.5.1.-, Application: WB, size: 100ug/vial
Catalog Number: 76173-200
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   GLI3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, A synthetic peptide corresponding to a sequence at the N-terminus of human Gli3, different from the related rat sequence by two amino acids, and from the related mouse sequence by one amino acid
Catalog Number: 10207-264
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76467-966
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Lyn Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn 470-501aa, Synonym: p53Lyn, p56Lyn, LYN, JTK8, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-434
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD23 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived mouse CD23 recombinant protein (Position: E50-P331). Mouse CD23 shares 52% amino acid (aa) sequence identity with human CD23
Catalog Number: 10209-864
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Leptin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Rat, Immunogen: E. Coli-derived rat Leptin recombinant protein (Position: V22-C167), Synonym: Leptin, Obesity factor, Lep, Ob, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-854
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
385 - 400  of 6,135
Prev   25  26  27  28  29  30  31  32  33  34  35  36  37  38  39  40  Next