Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76466-952
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-538
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-262
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   C5/C5a polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat C5a(1-18aa DLQLLHQKVEEQAAKYKH), different from the related mouse sequence by four amino acids.
Catalog Number: 10209-502
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-592
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   SP1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa), Synonym: Transcription factor Sp1, Application: Western blot, Size: 100ug/vial
Catalog Number: 76174-936
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MUC2, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD), Synonym: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC, Application: IHC-P, Size:100ug
Catalog Number: 76171-376
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Calbindin-D antibody, Monoclonal, Host: Mouse IgG1, Clone number: CB-D7, Synonyms: CALB/D-28K/CALBINDIN, 28-KD/Calbindin D28/Vitamin D-dependent calcium-binding protein, avian-type, Reactivity: Bovine, Human, Mouse, Rat, Immunogen: Bovine kidney calbindin-D.
Catalog Number: 10205-958
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   KRIT1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (703-736aa), Synonyms: Krev interaction trapped protein 1, Application: WB, size: 100ug/vial
Catalog Number: 76173-062
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76465-826
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Aquaporin 9 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Aquaporin 9(263-278aa VLFIQMHHSNPDPEVK). Application: WB
Catalog Number: 10206-396
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Apolipoprotein B Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human Apolipoprotein B recombinant protein (Q246-N450), Synonyms: Apolipoprotein B-100; Apo B-100, Application: WB, size: 100ug/vial
Catalog Number: 76172-998
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Connexin 32/GJB1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Connexin 32/GJB1(215-231aa RACARRAQRRSNPPSRK).
Catalog Number: 10206-212
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Mineralocorticoid Receptor Antibody, polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype:IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Mineralocorticoid Receptor(966-984aa DQLPKVESGNAKPLYFHRK).
Catalog Number: 10205-936
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*Cytochrome C Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived mouse Cytochrome C recombinant protein, Synonyms: Cytochrome c, somatic, Cycs, Application: IHC-P, Western blot, Size: 100ug/vial
Catalog Number: 76171-762
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PKC Eta Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human PKC eta recombinant protein, Synonyms: Protein kinase C eta type, 2.7.11.13, PKC-L, nPKC-eta, Application: WB, Size: 100ug/vial
Catalog Number: 76173-970
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
817 - 832  of 6,135
Prev   52  53  54  55  56  57  58  59  60  61  62  63  64  65  66  67  Next