Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76467-764
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CD22/Siglec 2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 696-724aa LAILILAICGLKLQRRWKRTQSQQGLQEN, Synonyms: B-cell receptor CD22, B-lymphocyte cell adhesion molecule, Size: 100ug/vial
Catalog Number: 76174-198
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Liver FABP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK, Synonyms: liver-type fatty acid-binding protein, L-FABP, FABP1, FABPL, Size: 100ug/vial
Catalog Number: 76174-028
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   BMP4 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human BMP4 recombinant protein (Position: S293-R408), Synonym: BMP-4, BMP-2B, BMP4, BMP2B, DVR4, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-960
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   P107 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human p107(1048-1068aa QENDDVLLKRLQDVVSERANH), identical to the related rat and mouse sequences.
Catalog Number: 10208-180
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CD14 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human CD14 recombinant protein, Synonyms: Monocyte differentiation antigen CD14, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-550
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   STAT3 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 139-167aa EKQQMLEQHLQDVRKRVQDLEQKMKVVEN, Synonyms: Signal transducer and activator of transcription 3, Application: WB, Size: 100ug/vial
Catalog Number: 76173-890
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   PD-L1/B7-H1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PD-L1/B7-H1 (41-69aa), Synonym: PDL1, Application: WB, Size:100ug
Catalog Number: 76170-798
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76464-990
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-502
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Ran Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Ran recombinant protein (Position: A2-L216), Synonym: GTPase Ran, Ras-like protein TC4, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-850
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TRPC3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TRPC3(836-851aa HSFNSILNQPTRYQQI), identical to the related rat and mouse sequences, Application:, IHC-P
Catalog Number: 10206-908
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ATF6 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa), Synonym: ATF6, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-122
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   WNT4 Polyclonal Antibody, Host: Rabbit, Species: Human Rat Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt4(232-249aa HALKEKFDGATEVEPRRV), identical to the related mouse and rat sequences, Application: Western Blot
Catalog Number: 10207-382
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Ataxin 3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (226-254aa), Synonyms: Ataxin-3; 3.4.19.12, Application: WB, size: 100ug/vial
Catalog Number: 76173-678
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   BMI1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(136-152aa EFFDQNRLDRKVNKDKE), different from the related mouse sequence by three amino acids
Catalog Number: 10207-288
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1,089 - 1,104  of 6,135
Prev   69  70  71  72  73  74  75  76  77  78  79  80  81  82  83  84  Next