Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76465-446
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   MAOA/Monoamine Oxidase A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER, Synonyms: Amine oxidase, Size: 100ug/vial
Catalog Number: 76173-792
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   CTGF/Ccn2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human CTGF recombinant protein, Synonyms: GF-binding protein 8, IGFBP-8, CTGF, CCN2, HCS24, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-948
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Talin 2 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region, Synonym: Talin-2, TLN2, KIAA0320, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-760
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Phospholamban polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Phospholamban(2-16aa EKVQYLTRSAIRRAS)
Catalog Number: 10209-190
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Cytokeratin 8 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Cytokeratin 8 recombinant protein (Position: D107-K325, Synonym: Kb8, KRT8, CYK8, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-432
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD163 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: E. coli-derived human CD163 recombinant protein(Position: F1056-L1165).
Catalog Number: 10209-614
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IGF1 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human IGF1(80-96 aa GSSSRRAPQTGIVDECC), different from the mouse and rat sequences by one amino acid
Catalog Number: 10207-152
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ALDH1B1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence at N-terminus (116-156aa), Synonyms: Aldehyde dehydrogenase X, mitochondrial, Application: WB, size: 100ug/vial
Catalog Number: 76172-932
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Peroxiredoxin 5 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Peroxiredoxin 5 recombinant protein (E66-D198), Synonyms: Peroxiredoxin-5, Application: WB, size: 100ug/vial
Catalog Number: 76173-602
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Calcineurin alpha antibody, Monoclonal, Host: Mouse IgG1, Clone number: CC-6, Synonyms: CNA2/CNB/CNB1/CALNB1/Protein phosphatase 2B regulatory subunit 1, Reactivity: Bovine, Human, Rat, Immunogen: Bovine brain calcineurin.
Catalog Number: 10206-114
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   TRAF3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TRAF3(387-403aa RHDQMLSVHDIRLADMD), identical to the related rat and mouse sequences, Application: Western Blot
Catalog Number: 10206-964
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Livin Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived human Livin recombinant protein, Synonym: Baculoviral IAP repeat-containing protein 7, Application: Western blot (WB), ELISA, Size: 100 ug/vial
Catalog Number: 76174-952
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PTOV1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-term of human PTOV1 (385-414aa), Synonym: Prostate tumor-overexpressed gene 1 protein, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-962
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   AGP1/alpha 1 acid glycoprotein Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human ORM1 recombinant protein, Synonyms: Alpha-1-acid glycoprotein 1, Size: 100ug/vial
Catalog Number: 76174-750
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CXCL16 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CXCL16(103-116aa HGKSFHHQKHLPQA).Application: WB, IHC-P
Catalog Number: 10208-026
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
449 - 464  of 6,135
Prev   29  30  31  32  33  34  35  36  37  38  39  40  41  42  43  44  Next