Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Product Image
Description:   HYAL1 Polyclonal Antibody, Host: Rabbit, Species: mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse HYAL1(434-450aa LKDRAQMAMKFRCRCYR), different from the related rat sequence by one amino acid, Application: Western Blot
Catalog Number: 10207-018
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Annexin A3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence in the middle region (153-184aa), Synonyms: Annexin A3;, Application: WB, size: 100ug/vial
Catalog Number: 76173-672
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Dynamin 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Dynamin 1 recombinant protein (Position: W616-D667), Synonym: Dynamin-1, DNM1, DNM, Application: ELISA, Flow Cytometry, IHC-P, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76171-634
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Apg7 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, Rat, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Apg7, Application: WB.
Catalog Number: 10210-010
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*Laminin Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: Peptide mixture of laminin gamma1, 2, 3, Synonyms: Laminin subunit gamma-1, Laminin B2 chain, Application: IHC-P, Western blot, Size: 100ug/vial
Catalog Number: 76171-758
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Nmt55/p54nrb Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ, Synonyms: Non-POU domain-containing octamer-binding protein, Size: 100ug/vial
Catalog Number: 76174-590
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Picoband*Annexin VIII Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: Synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII, Synonym: Annexin A8, Annexin VIII, Annexin-8, Uses: WB, Size: 100ug/vial
Catalog Number: 76172-014
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Unconjugated Goat Anti-mouse IgG secondary antibody This antibody is specific for mouse IgG and shows no cross-reactivity with human/bovine/rabbit IgG, Application: ELISA, IF, IHC-P, IHC-F, ICC, WesternBlot, Pack size: 5mg
Catalog Number: 10207-540
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IGFBP2 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human IGFBP2 recombinant protein (Position: A36-Q325), Synonym: IGFBP2, BP2, IBP2, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-412
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MAK Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa), Synonym: Serine/threonine-protein kinase MAK, Application: WB, Size:100ug
Catalog Number: 76171-012
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Haptoglobin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Immunogen: syntic peptide corresponding to a sequence in middle region (128-160aa), Synonyms: Haptoglobin; Zonulin, Application: WB, size: 100ug/vial
Catalog Number: 76173-304
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Gremlin 1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD, Synonyms: Gremlin-1, Cell proliferation-inducing gene 2 protein, Application: WB, Size: 100ug/vial
Catalog Number: 76174-108
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   GNB1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus of human GNB1 (2-42aa), Synonyms: GNB1, Application: Western blot, size: 100ug/vial
Catalog Number: 76173-048
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IKK alpha polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IKK alpha(728-745aa NEEQGNSMMNLDWSWLTE).
Catalog Number: 10209-426
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Synaptotagmin 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human Synaptotagmin 1 (RRPIAQWHTLQVEEEVDAMLAVKK), Synonym: SYT, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-604
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-954
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
881 - 896  of 6,135
Prev   56  57  58  59  60  61  62  63  64  65  66  67  68  69  70  71  Next