Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Description:   TAPA1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: E. Coli-derived mouse TAPA1 recombinant protein (Position: K116-K201), Synonym: CD81 antigen, 26 kDa cell surface protein TAPA-1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-392
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   RSK1 p90 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RSK1 p90(721-735aa ILAQRRVRKLPSTTL), identical to the related rat and mouse sequences.
Catalog Number: 10206-590
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Caspase-8(P18) antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Caspase-8(P18)(240-259aa DKVYQMKSKPRGYCLIINNH)
Catalog Number: 10207-980
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Catalog Number: 76463-826
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   NOTCH4 antibody, Polyclonal, Host: Rabbit IgG, Synonyms: FLJ16302 antibody/hNotch 4 antibody, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NOTCH4(1805-1818aa DVAHQRNHWDLLTL). Application: WB
Catalog Number: 10206-716
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Beta Arrestin 2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Arrestin 2(395-409aa RLKGMKDDDYDDQLC)
Catalog Number: 10209-160
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Kv1.2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV, Synonyms: Potassium voltage-gated channel subfamily A member 2, Application: WB, Size: 100ug/vial
Catalog Number: 76174-154
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL-2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human IL-2 recombinant protein (Position: A21-T153), Synonym: Interleukin-2, IL-2, T-cell growth factor, TCGF, Aldesleukin, IL2, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-000
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   CD20 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human CD20 recombinant protein (Position: M1-D261). Human CD20 shares 75% amino acid (aa) sequence identity with mouse CD20
Catalog Number: 10209-700
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   NADPH oxidase 4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse NADPH oxidase 4(561-578aa NRNNSYGTKFEYNKES).
Catalog Number: 10206-282
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   DyLight 488 Conjugated Goat Anti-mouse IgG This DyLight 488 conjugated antibody is specific for mouse IgG and shows no cross-reactivity with human/bovine/rabbit IgG, Application: FCM, IHC-P, IHC-F, ICC, Pack size: 0.5mg
Catalog Number: 10207-548
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   ABCA4 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse ABCA4(1892-1903aa TLLIQHHFFLTR), identical to the related rat sequence.
Catalog Number: 10209-656
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL-22 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human IL-22 recombinant protein (Position: A34-I179), Synonym: IL22, ILTIF, ZCYTO18, UNQ3099/PRO10096, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-244
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   NCF1/P47Phox Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human NCF1 recombinant protein (Position: M1-D270), Synonym: p47-phox, NCF1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-470
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   IKK Beta Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human IKK beta recombinant protein (E398-S756), Synonyms: Inhibitor of nuclear factor kappa-B kinase subunit beta, Application: WB, size: 100ug/vial
Catalog Number: 76173-308
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   SERPINA1/Alpha 1 Antitrypsin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human SERPINA1 recombinant protein(E25-T204), Synonym: Alpha-1-antitrypsin, Application: WB, size: 100ug/vial
Catalog Number: 76173-108
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1,105 - 1,120  of 6,135
Prev   70  71  72  73  74  75  76  77  78  79  80  81  82  83  84  85  Next