Keep your session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Category
  • Supplier
  • Suppliers found in search results
    Sort by:

You Searched For:

Boster Biological Technology

6,135  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
 
SearchResultCount:"6135"
Searching List View List View Easy View 
Sort by:
 
 
 
 

Vendor Image
Catalog Number: 76465-786
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Nebulin antibody, Monoclonal, Host: Mouse IgG1, Clone number: Neb-20, Synonyms: NEM2/NEB177D, Reactivity: Chicken, Immunogen: Chicken breast nebulin. Application: WB
Catalog Number: 10206-066
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   HMGB2/Hmg2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: syntic peptide corresponding to a sequence at N-terminus (65-97aa), Synonyms: HMG-2; HMGB2; HMG2;, Application: WB, size: 100ug/vial
Catalog Number: 76172-886
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Ca2/Carbonic Anhydrase Ii Picoband* Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human CA2 recombinant protein, Synonym: CAC, CA-II, CA2, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-838
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   ABCG8 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: corresponding to a sequence in the middle region of human ABCG8 (328-371aa), Synonym: ATP-binding cassette sub-family G member 8, Sterolin-2, ABCG8, Application: WB, Size:100ug
Catalog Number: 76171-454
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Catalog Number: 76464-910
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   Hsp40 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp40(317-332aa EFEVIFPERIPQTSRT)
Catalog Number: 10209-530
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   Unconjugated Rabbit Anti-goat IgG secondary antibody This antibody is specific for goat IgG and shows no cross-reactivity with human/rat/mouse/rabbit IgG, Application: ELISA, IF, IHC-P, IHC-F, ICC, WesternBlot, Pack size: 5mg
Catalog Number: 10207-534
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   PTEN Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human PTEN recombinant protein (E91-V403), Synonyms: Phosphatase and tensin homolog; PTEN; MMAC1, TEP1, Application: WB, size: 100ug/vial
Catalog Number: 76173-604
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   APE1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human APE1(177-191aa RGLVRLEYRQRWDEA), identical to the related rat and mouse sequences.
Catalog Number: 10209-756
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   HDJ2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDJ2(369-384aa NQERRRHYNGEAYEDD), identical to the related rat and mouse sequences
Catalog Number: 10209-770
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   IL22 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse IL22 recombinant protein (Position: L34-V179), Synonym: IL-22a, Il22, Il22a, Iltif, Iltifa, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-248
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Product Image
Description:   NR3C1/Glucocorticoid Receptor Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human NR3C1 recombinant protein M1-D373, Synonym: Glucocorticoid receptor, Application: WB, size: 100ug/vial
Catalog Number: 76173-330
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   MICA Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK, Synonyms: MHC class I polypeptide-related sequence A, MIC-A, MICA, Application: WB, Size: 100ug/vial
Catalog Number: 76174-080
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   TRIF Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse TRIF (53-84aa), Synonym: TIR domain-containing adapter molecule 1, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-986
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Vendor Image
Description:   APC2 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa), Synonyms: Adenomatous polyposis coli protein 2, Application: WB, size: 100ug/vial
Catalog Number: 76172-996
Supplier: Boster Biological Technology



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1,073 - 1,088  of 6,135
Prev   68  69  70  71  72  73  74  75  76  77  78  79  80  81  82  83  Next