Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
So much has changed during this unprecedented time, except your ability to count on Avantor. We continue to set science in motion to create a better world by providing you with the right solutions to keep moving forward.
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
Avantor supports end-to-end fluid management solutions – including peristaltic pumps and aseptic fluid transfer solutions – that are reliable and customer-centric, helping bioprocessing manufacturers meet their research and production goals.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
New Avantor® J.T.Baker® premium conductive and non-conductive robotic tips deliver superior quality and reliable performance for results you can trust.
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
The Equipment & Instrument Service Team’s focus is to provide comprehensive service solutions for our customers. We provide validation, calibration, preventative maintenance, and extended warranties on all equipment & instruments in and around the laboratory.
An assay is an investigative procedure in laboratory medicine, pharmacology, environmental biology, and molecular biology for qualitatively assessing or quantitatively measuring the presence or functional activity of the analyte, or the entity being targeted by the assay. Generally, assays involve biological materials or phenomena which tend to be intrinsically more complex in composition or in behavior than what can be handled by traditional chemical analysis and titration.
Description:
HDAC-Glo* I/II Assay, single-reagent-addition, homogeneous, luminescent assays that measure the relative activity of histone deacetylase (HDAC) class I and II enzymes from cells, extracts or purified enzyme sources, acetylated, luminogenic peptide substrate, Size:100ml
Description:
Akt2 Kinase Enzyme Easily Screen and Profile AKT2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
IGF1R Kinase Enzyme System, recomb human iIGF1R expressed by baculovirus in SF9 insect cells using an n-terminal His tag, transmembrane tyrosine kinase receptor that is activated by IGF-1 & by the related growth factor IGF-2, Storage: -70 deg C, Size: 1 mg
Description:
HER4 Kinase Enzyme System, recomb human her4 (amino acids 682-993) expressed by baculovirus in sf9 insect cells using an n-terminal gst tag, HER4 is a transmembrane receptor tyrosine kinase that belongs to the epidermal growth factor receptor family, Storage: -70 deg C, Size: 1 mg
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.
Description:
Recombinant full-length human AMPK (combination of A2/B1/G1 subunits) was expressed by baculovirus in Sf9 insect cells using a C-terminal His tag. It plays a key role in insulin signaling pathway and is a major therapeutic target for the treatment of diabetes.
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.Virtual kit consisting of ADP-Glo 1000 assay AKP package and EGFR Kinase Enzyme System AKP packaged kit
Description:
ADP-Glo* Kinase Assay with PIP2:3PS, Features: Employ Complete Solutions for Class I PI3Ks, Observe Excellent Selectivity, Obtain Reliable Results, Save Time, Avoid False Hits, size: 10, 000 assays
Description:
Grk5 Kinase Enzyme Easily Screen and Profile GRK5 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.
Description:
Recombinant human HIPK3 (163–562) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. JNK regulates the expression of HIPK3 in prostate cancer cells and this contributes to increased resistance to Fas receptor-mediated apoptosis.
Description:
Tbk1 Kinase Enzyme Easily Screen and Profile TBK1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Recombinant full-length human PKC? was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Protein Kinase C theta (PKC?) is an important component in the intracellular signaling cascade
Description:
MSK2 Kinase Enzyme, Easily Screen and Profile MSK2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
NUAK2 Kinase Enzyme System, Easily Screen and Profile NUAK2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
IKKB Kinase Enzyme System, with ADP-Glo* Assay, Easily Screen and Profile IKKB Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
Recombinant mouse epha1 (amino acids 569-end) expressed by baculovirus in sf9 insect cells using an n-terminal GST tag. EPHA1 is a member of the eph family of receptor tyrosine kinases that have been implicated in mediating developmental events, Size: 1 mg
Description:
Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle.
Description:
Recombinant full-length human SLK was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. Inhibition of SLK activity by dominant-negative mutant or RNAi leads to unfocused microtubule arrangement indicating it is needed for microtubule organization.
Description:
Rsk1 Kinase Enzyme System, Easily Screen and Profile Rsk1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
P38 Beta Kinase Enzyme System, Easily Screen and Profile P38 Beta Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
MRCK alpha Kinase Enzyme System, Easily Screen and Profile MRCK alpha Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
Rock2 Kinase Enzyme System, Easily Screen and Profile Rock2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
MlCK Kinase Enzyme System, Easily Screen and Profile mlCK Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
Pdgfr Alpha (D842V) Kinase Enzyme System, Easily Screen and Profile Pdgfr Alpha (D842V) Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
EGFR (L861Q) Kinase Enzyme, Easily Screen and Profile EGFR (L861Q) Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.Virtual kit consisting of ADP-Glo 1000 assay AKP package and ITK Kinase Enzyme System AKP packaged kit
Description:
Alk2 Kinase Enzyme System, Easily Screen and Profile Alk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Ret (V804L) Kinase Enzyme System, Easily Screen and Profile Ret (V804L) Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Clk1 Kinase Enzyme System, Easily Screen and Profile Clk1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Cmgc-2 Kinase Selectivity Profiling System, Selectivity Screening of Library Compounds for Effect on Tyrosine Kinases, Kinase and substrate pairs organized in an easy-to-use 8-tube strip format, With ADP-Glo* Assay, Size: 8x50reaction
Description:
P450-Glo* CYP2B6 Screening Systems, includes complete set of reagents, Luminescent format eliminates need for time-consuming analyses, Broad dynamic range and low background, assay employs luminogenic P450 substrates, Size: 1000 assays
Description:
AURORA A Kinase Enzyme Easily Screen and Profile AURORA A Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
Msk1 Kinase Enzyme System, Easily Screen and Profile Msk1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Vrk2 Kinase Enzyme System, Easily Screen and Profile Vrk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Substrate: PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC); derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
Description:
ERK1 Kinase Enzyme Easily Screen and Profile ERK1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
JNK3 Kinase Enzyme Easily Screen and Profile JNK3 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
CDK5/P25 Kinase Enzyme Easily Screen and Profile CDK5/P25 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, with Add ADP-Glo* Assay, Size: 10ug
Description:
SRC Kinase Enzyme System, Recombinant full-length human SRC was expressed in E. coli cells using an N-terminal GST tag, identified as a transforming protein of the Rous sarcoma virus, overexpressed and activated in human malignancies, Storage: -70 deg C, Size: 1 mg
Description:
AKT1 Kinase Enzyme System, Expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag, Involved in glucose metabolism, transcription, survival, cell proliferation, angiogenesis, cell motility, Active in many types of human cancers, Storage: -70 deg C, Size: 1 mg
Description:
Ck1 Alpha 1 Kinase Enzyme System, Easily Screen and Profile Ck1 Alpha 1 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.Virtual kit consisting of ADP-Glo 1000 assay AKP package and ZAP70 Kinase Enzyme System AKP packaged kit
Description:
The ADP-Glo* Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g. kinase or ATPase) using up to 1mM ATP.Virtual kit consisting of ADP-Glo 1000 assay AKP package and CHK1 Kinase Enzyme System AKP packaged kit
Description:
CDC7/DBF4 Kinase Enzyme System, Easily Screen and Profile CDC7/DBF4 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 10ug
Description:
Hipk3 Kinase Enzyme System, Easily Screen and Profile Hipk3 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Pyk2 Kinase Enzyme System, Easily Screen and Profile Pyk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Recombinant full-length human CDK6 and CyclinD3 were co-expressed by baculovirus in Sf9 insect cells using an N-terminal His tag on both proteins. CDK6 activity is regulated by the D-type cyclins and members of the INK4 family of CDK inhibitors.
Description:
Msk2 Kinase Enzyme System, Easily Screen and Profile Msk2 Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg
Description:
Pkc Theta Kinase Enzyme System, Easily Screen and Profile Pkc Theta Kinase Inhibitors, Includes kinase, substrate and reaction buffer, Use with ADP-Glo* Assay for bioluminescent detection of kinase activity, Size: 1mg